TABLE 2

Pheromone precursors encoded by the B42 genes

GeneAmino acid sequence of precursora
phbl.1MDSFDSLDSLNLSVEETTLQTLLESMDTTDAASESELDAILVNSERDPGFTSKGFCVIA
phbl.2MDSFQQLNLFVEETIQQSLPEAIPSSDSTDTGASERDATPVNTERHLGFTTKGFCVVS
phb2.1MDSFSTLSLPATLGNEEAQQTTVIATVAQPQESPSSSGTPVDSERPGAGKVRAFCIIA
phb2.2MDNFTVDLATLFEEFPELQEIQATASEHCSQDQYGSCEGPPINQERPGSGVNRAFCVIA
phb3.1MDSGNTVDLAELCDMDPNIGFTPDSSAPTEDNVAKQLVDSDQRLPGGYYGGQCIIA
phb3.2MSDAFTTLDTVDLFIEENEQEVVEVPSCPPPRRPSFSSADAESIFLTVEEVNDLPVDYERRTQGGGGLTWFCVIA
  • a The predicted N-terminal processing site is underlined, and the predicted sequence of the mature pheromone is given in boldface type.