- THIS ARTICLE
-
Abstract
- Full Text (PDF)
- Data Supplement
-
All Versions of this Article:
genetics.108.093302v1
180/4/2095 most recent - Alert me when this article is cited
- Alert me if a correction is posted
- SERVICES
- Email this article to a friend
- Similar articles in this journal
- Similar articles in PubMed
- Alert me to new issues of the journal
- Download to citation manager
- Reprints & Permissions
- CITING ARTICLES
- Citing Articles via Google Scholar
- GOOGLE SCHOLAR
- Articles by Melicharek, D.
- Articles by Marenda, D. R.
- Search for Related Content
- PUBMED
- PubMed Citation
- Articles by Melicharek, D.
- Articles by Marenda, D. R.
Originally published as Genetics Published Articles Ahead of Print on October 1, 2008.
Genetics, Vol. 180, 2095-2110, December 2008, Copyright © 2008
doi:10.1534/genetics.108.093302
Identification of Novel Regulators of atonal Expression in the Developing Drosophila Retina
David Melicharek*,1,
Arpit Shah
,1,
Ginnene DiStefano*,
Andrew J. Gangemi
,
Andrew Orapallo
,
Alysia D. Vrailas-Mortimer
and
Daniel R. Marenda*,2
* Department of Bioscience and Biotechnology, Drexel University, Philadelphia, Pennsylvania 19104,
Department of Biological Sciences, University of the Sciences in Philadelphia, Philadelphia, Pennsylvania 19104 and
Department of Cell Biology, Emory University School of Medicine, Atlanta, Georgia 30322
2 Corresponding author: Department of Bioscience and Biotechnology, Drexel University, 3141 Chestnut St., Philadelphia, PA 19104.
E-mail: daniel.marenda{at}drexel.edu
Atonal is a Drosophila proneural protein required for the proper formation of the R8 photoreceptor cell, the founding photoreceptor cell in the developing retina. Proper expression and refinement of the Atonal protein is essential for the proper formation of the Drosophila adult eye. In vertebrates, expression of transcription factors orthologous to Drosophila Atonal (MATH5/Atoh7, XATH5, and ATH5) and their progressive restriction are also involved in specifying the retinal ganglion cell, the founding neural cell type in the mammalian retina. Thus, identifying factors that are involved in regulating the expression of Atonal during development are important to fully understand how retinal neurogenesis is accomplished. We have performed a chemical mutagenesis screen for autosomal dominant enhancers of a loss-of-function atonal eye phenotype. We report here the identification of five genes required for proper Atonal expression, three of which are novel regulators of Atonal expression in the Drosophila retina. We characterize the role of the daughterless, kismet, and roughened eye genes on atonal transcriptional regulation in the developing retina and show that each gene regulates atonal transcription differently within the context of retinal development. Our results provide additional insights into the regulation of Atonal expression in the developing Drosophila retina.
A fundamental question in developmental biology is the control of neurogenesis. Proper neural development underlies the basic cellular processes required within all cells of the mature nervous system. Neurophysiology, and even broader processes such as consciousness or intelligence intimately depend upon proper developmental control of cells within the nervous system. The developing eye of the fruit fly Drosophila melanogaster serves as an excellent system to model how neurogenesis is controlled within a developing nervous tissue. The adult Drosophila eye consists of
800 regularly spaced unit eyes, called ommatidia. Each ommatidium contains 20 cells: 8 photoreceptor neurons (R1–R8) and 12 accessory cells (cone, pigment, and bristle cells) arranged in a stereotypical array (READY et al. 1976; HSIUNG and MOSES 2002; MOLLEREAU and DOMINGOS 2005), and each of which requires exquisite precision in their morphology for proper function. This morphological exactness requires precision in development. Development of the eye begins as a monolayer field of undifferentiated columnar epithelial cells (the eye/antennal imaginal disc). These cells grow by random proliferation until, during the early third instar larval stage, a wave of differentiation, marked by a band of cells with constricted apical actin cytoskeletal rings (the morphogenetic furrow) begins at the posterior margin of the presumptive eye disc and sweeps anteriorly across the eye field. As the furrow moves across the disc, new columns of precisely spaced retinal founder cells (the R8 photoreceptor cell) are specified roughly every 2 hours (READY et al. 1976; BASLER and HAFEN 1989; WOLFF and READY 1993). The central event in R8 founder cell specification is the initial expression and eventual refinement of the proneural transcription factor Atonal (Ato) within the developing R8 neuron (JARMAN et al. 1994; WHITE and JARMAN 2000).
Ato protein is initially expressed in a broad stripe of cells just anterior to the morphogenetic furrow (Figure 1A) (JARMAN et al. 1994). At the leading edge of the furrow, Ato expression is refined to small clusters of
20 cells, the "intermediate groups" (arrows in Figure 1B) (JARMAN et al. 1995). Later, within the furrow, Ato expression is refined to single cells, the future R8 photoreceptor cells (arrowheads in Figure 1B) (JARMAN et al. 1995; BAKER et al. 1996). Ato expression is eventually lost in these founder cells as the furrow advances more anteriorly, although the R8 cell fate is maintained through the expression of Senseless within the R8 (FRANKFORT et al. 2001). atonal transcriptional regulation is very dynamic. atonal transcription is regulated by two separate control regions near the atonal gene (SUN et al. 1998). Genomic DNA flanking the 5' end of the gene regulates the late phase of atonal expression in the intermediate groups and single R8s (Figure 1C) (SUN et al. 1998), while genomic DNA flanking the 3' end of the gene regulates the early phase of atonal expression in the initial broad stripe anterior to the furrow (Figure 1D) (SUN et al. 1998).
|
After R8 founder cell specification, the remaining neurons (R1–R7) are recruited into the developing ommatidia by inductive signals through the epidermal growth factor receptor (Egfr)/Ras/MAP kinase pathway (Figure 1E) reviewed in FREEMAN (1997, 1998). Each photoreceptor neuron is distinguishable from the others within the ommatidium by the order in which the neuron is specified and by the position it takes within the developing ommatidial cluster. Thus, R2/R5 are recruited into the ommatidium first, followed by R3/R4, R1/R6, and lastly R7 (READY et al. 1976; TOMLINSON and READY 1987). The correct expression and spacing of Ato protein is crucial to this proper developmental progression of photoreceptor development, and in ato mutants, no photoreceptors are formed, and surviving adults are nearly eyeless (JARMAN et al. 1994, 1995).
In review, retinal neurogenesis in the developing fly eye may be considered in three phases: 0, 1, and 2 (Figure 1). In phase 0, ahead of the morphogenetic furrow, cells are undifferentiated and randomly proliferating. Phase 1 is marked by the establishment of the ommatidial founder cells (the R8 neuron), through progressively restricted expression of Atonal. In phase 2, posterior to the morphogenetic furrow, the remaining neurons of the ommatidial cluster are recruited in a set pattern and sequence. For the eye to function normally, these developmental events must be precisely and faithfully carried out. Any abnormality or deviation in this process disrupts this delicate dance of development and further, may be detected through disruption of the external morphology of the adult eye (so-called "rough eye" phenotypes).
There are striking similarities between fly and vertebrate eye development, such as the process of specifying and spacing the first retinal neural cell type. In vertebrates, expression of bHLH transcription factors orthologous to Drosophila Atonal (MATH5/Atoh7, XATH5, and ATH5) and their progressive restriction are also involved in specifying the retinal ganglion cells, the founding neural cell type in mammals, in a process similar to Drosophila R8 photoreceptor development (BROWN et al. 1998, 2001; PERRON et al. 1998; HASSAN and BELLEN 2000; PERRON and HARRIS 2000; HUTCHESON and VETTER 2001; VETTER and BROWN 2001; WANG et al. 2001; YAN 2005). Thus, a more complete understanding of what transcription factors are required for R8 specification in Drosophila eye development, and how and when these transcription factors regulate Atonal expression, will likely be of very broad relevance to our understanding of the process of mammalian retinal development and are important to fully understand how retinal neurogenesis is accomplished.
We have taken a genetic approach to understanding the mechanisms that control Drosophila retinal neurogenesis in the morphogenetic furrow (phase 1), by undertaking a genetic modifier screen based on an ato loss-of-function genotype that displays a rough eye phenotype. We screened for dominant enhancers of this phenotype and report here the identification of five genes, three of which are novel ato regulators. We show that daughterless, a gene previously identified to affect Atonal protein expression, regulates atonal transcription both negatively and positively from the two different atonal enhancer elements. We further show that kismet gene function is positively required for atonal transcription at both atonal enhancer elements. We show that kismet gene function is precisely required for events within the morphogenetic furrow, but is dispensable for the expression of genes required for retinal development anterior or posterior to the furrow. Importantly, we show that mutations in other chromatin remodeling factors (brahma, osa, snr1) do not affect Atonal expression, while mutations in Trithorax do. As many of these chromatin remodeling factors affect eye development both anterior and posterior to the furrow, our findings provide an intriguing specificity to Kismet-mediated chromatin remodeling in retinal development. Finally, we characterize the expression and contribution of the Roughened Eye protein in atonal transcriptional regulation. We show that roughened eye gene function positively regulates atonal transcription from only one of the two known atonal genomic enhancer elements. Our results provide additional insights into the regulation of atonal expression within the morphogenetic furrow, further illustrating the complex developmental regulation this proneural gene undergoes during eye development. Further, as each of the genes we identified in our screen in Drosophila have mammalian homologs, our results may also implicate these genes in mammalian retinal development as well.
Drosophila stocks:
Unless otherwise noted, all crosses were carried out at 25° on standard cornmeal–molasses–agar medium. BL number refers to Bloomington Stock Center stock number. Stocks used: ato1090 (also called atots, described here), Df(3R)p13 [BL 1943 ato1 and ato3 (JARMAN et al. 1994, 1995)], atonal-lacZ enhancer trap lines (both 5'F:9.3 and 3'F:5.8) are described in SUN et al. (1998), hhAC (LEE et al. 1992), EgfrE1 (BAKER and RUBIN 1989, 1992), lilliXS407 (gift from Amy Tang) (TANG et al. 2001), lilliXS575 (gift from Amy Tang) (TANG et al. 2001), lilliA17-2 (gift from Arno Muller) (MULLER et al. 2005), lilliS35 (NEUFELD et al. 1998a), kis1 (KENNISON and TAMKUN 1988), kisk13416 (ROCH et al. 1998; SRINIVASAN et al. 2005), roe1 (MA et al. 1996), roe3 (ST PIERRE et al. 2002), rn19 (ST PIERRE et al. 2002), rn16 (ST PIERRE et al. 2002), rn5 (AGNEL et al. 1989), smo3 P{neo FRT} 40A (VRAILAS and MOSES 2006), tkv8 P{neo FRT} 40A (VRAILAS and MOSES 2006), smo3, tkv8 P{neo FRT} 40A (VRAILAS and MOSES 2006), daUX P{neo FRT} 40A (synonym da10, gift from Claire Cronmiller) (BROWN et al. 1996), da1 (BELL 1954), eya2 (BONINI et al. 1993), Star1 (LEWIS 1945; HIGSON et al. 1993), DlRevF10 SerRX82 P{neoFRT}82B (ZENG et al. 1998), osa308 P{neoFRT}82B (TREISMAN et al. 1997; JANODY et al. 2004), trxE2 P{neoFRT}82B (JANODY et al. 2004), brmT485 P{neoFRT}80B (JANODY et al. 2004), and snr1R3 P{neoFRT}82B (ZRALY et al. 2003).
Mosaic clones:
Mosaic clones were generated using ey:FLP (NEWSOME et al. 2000), as described (XU and RUBIN 1993). Flip stocks (1) y–, w–, ey:FLP; Ubi-GFP, P{neoFRT}80B; (2) y–, w–, ey:FLP; Ubi-GFP, P{neoFRT}82B; and (3) y–, w–, ey:FLP; Ubi-GFP, P{neoFRT}40A were crossed to the following stocks as appropriate to generate mutant clones:- w–; kisLM27, P{neoFRT}40A/Cyo
- w–; kisLM27, P{neoFRT}40A, 5' ato-lacZ/Cyo
- w–; kisLM27, P{neoFRT}40A, 3' ato-lacZ/Cyo
- w–; kisEC1, P{neoFRT}40A/Cyo
- w–; smo3 P{neo FRT} 40A/Cyo
- w–; tkv8 P{neo FRT} 40A/Cyo
- w–; smo3, tkv8, P{neo FRT} 40A/Cyo
- DlRevF10 SerRX82 P{neoFRT}82B/TM6B
- w–; daUX P{neo FRT} 40A/Cyo
- w–; daUX P{neo FRT} 40A, 5' ato-lacZ/Cyo
- w–; daUX P{neo FRT} 40A, 3' ato-lacZ/Cyo
- w–; osa308 P{neoFRT}82B/TM6B
- w–; brmT485 P{neoFRT}80B/TM6B
- w–; trxE2 P{neoFRT}82B/TM6B
- w–; snr1R3 P{neoFRT}82B/TM6B
Mutagenesis screen:
A schematic of the genetic screen used is provided in supplemental Figure 2. For chemical mutagenesis, isogenic males of the genotype w–; p[w+]/p[w+]; Df(3R)p13/TM3 [where the Df(3R)p13 chromosome removes the atonal locus] were treated with 25 mM EMS (Sigma) as described (ASHBURNER 1989). These males were then crossed to w–; ato1090/ato1090 virgin females at 25°, and F1 males or virgin females were scored under Leica dissecting microscopes for enhancement of the base Df(3R)p13/ato1090 eye phenotype at 25° (see Figure 2E). Df(3R)p13 corresponds to Bloomington Stock no. 1943. p[w+] refers to the transposable element insertion P{EP}EP2178 from the Szeged Drosophila Stock Centre, which itself does not modify the base Df(3R)p13/ato1090 eye phenotype at 25°. Mutations that affected this P-insertion (resulting in white-eyed flies) were used as a measure of the efficiency of mutagenesis. F1 males or virgin females of the genotype w–; p[w+], */+; Df(3R)p13, e, */ato1090, where * indicates the presence of the modifying mutation, were then crossed to w–; ato1090/TM6B, and those mutants that retained the observed enhancement in these F1 progeny were used to create independent stocks. Those mutants that failed to reproduce the observed enhancement were discarded. A full description of the genetic mapping is described in the supplemental Results.
|
Atonal antibody preparation:
The ato reading frame fused to the His6 tag and inserted into the pRSET vector (a gift from Andrew Jarman, see JARMAN et al. 1995) was used to express and isolate Atonal protein. The protein was purified and used to immunize two guinea pigs (Covance) and two rabbits (Zymed).For Roe antibody production, genomic antibodies were produced from Strategic Diagnostics (http://www.sdix.com/) according to the manufacturer's protocol. The following amino acid sequence was used from the Roe N-terminal specific sequence: VSSSSGSSSTAGPAPTGSTRGRKSRIYPNPNQHIIVTSNSVDNGGIRMQNATLNERNSQNSSAGAAGVGNVTTAAGSGNGISSSTSSPHHMTQLDVKDTK.
Immunohistochemistry and microscopy:
Eye disc preparations were as described (TIO and MOSES 1997) mounted in Vectashield (Vector Laboratories, H-1000), and imaged by confocal microscopy using a Nikon Eclipse TE2000-U laser-scanning confocal microscope. Primary antibodies: guinea pig anti-Atonal (1:1000, described in this study), rabbit anti-Roughened Eye (1:50, described in this study), rat anti-ELAV (1:500, 7E8A10 from Developmental Studies Hybridoma Bank), rabbit anti-Kismet-L (1:100, gift of J. Tamkun; SRINIVASAN et al. 2005), mouse anti-Daughterless (1:50, gift of C. Cronmiller; BROWN et al. 1996), and rabbit anti-β-galactosidase (1:1000, Cortex Biochem CA2190). Secondary antibodies were from Jackson ImmunoResearch: goat anti-mouse Cy5 (1:500, 115-175-003) and goat anti-rabbit TRITC (1:250, 111-025-003).Adult eyes were immersed in 100% ethanol, and digital photographs were taken under a Leica mZ 12.5 stereomicroscope, using an attached Leica digital camera.
Characterization of a temperature-sensitive loss-of-function atonal genetic background:
The ato1090 mutation (henceforth referred to as atots, a generous gift from V. Rodrigues) was initially isolated in an EMS screen designed to identify second-site modifiers of a lozenge phenotype and was subsequently tested for complementation with the Df(3R)p13 deficiency [henceforth referred to as Df(ato)], which removes the atonal locus. Heterozygous atots/+ flies show no dominant effect on adult eye morphology at either 18° or 29° (Figure 2B). Similarly, eyes from heterozygous flies containing Df(ato) also show no dominant effect on adult eye morphology at 29° (Figure 2C). However, when atots is crossed in trans to Df(ato), adult eye morphology is severely disrupted at 29° (Figure 2D), showing loss of nearly all photoreceptors and a strongly reduced eye size. When these flies are raised at either 25° or 18°, eye size and morphology are strongly rescued (Figures 2E and data not shown), although these eyes still display a rough eye phenotype. Df(ato) has been previously used to examine atonal-specific loss-of-function effects in transheterozygous mutant combinations (JARMAN et al. 1994, 1995; BAKER et al. 1996). However, Df(ato) deletes genes other than atonal. To verify that the phenotypic effects observed from our atots allele were due to a decrease specifically in atonal gene function, we analyzed transheterozygous combinations of atots with two other atonal mutants (ato1 and ato3). Both of these alleles are strong loss-of-function mutations in the atonal gene (JARMAN et al. 1994, 1995). In each case, transheterozygous mutant combinations of atots/ato1 and atots/ato3 produced small rough eyes at 25° very similar to the phenotype observed in the atots/Df(ato) genotype at 25° (Figure 2F and data not shown). Thus, these data suggest that the small rough eye phenotype of the atots/Df(ato) genotype is due to loss of atonal gene function within the Df(ato) stock and not due to effects from removal of other loci within this deficiency.We next analyzed Atonal protein expression in the atots/Df(ato) mutant background at two different temperatures (25° and 29°) and found that the precise expression and refinement of Atonal is disrupted. At 25° there is a defect in the refinement of Atonal protein into R8 cells (compare arrows in Figure 2G to arrowhead in Figure 2H). This is consistent with what has been previously reported for Atonal protein and atonal mRNA in the ato1/Df(ato) loss-of-function atonal genetic background (JARMAN et al. 1995). At 29° this effect is more dramatic, with a reduction in Atonal expression both ahead of the furrow (arrow in Figure 2I) and no expression within R8 cells posterior to the furrow (arrowhead in Figure 2I).
Although they are reduced and morphologically abnormal, adult eyes still form in the atots/Df(ato) mutant backgrounds, even though the only functional copy of the atonal gene comes from the atots mutant. Taken together, these data suggested that (1) the atots allele is a temperature-sensitive, loss-of-function allele that still produces functional Atonal protein at both 25° and 29°; (2) the atots/Df(ato) atonal eye phenotype is due to decreased (although not absent) Atonal protein expression, where R8 refinement within the developing retina is strongly impaired; and (3) the rough eye phenotype of transheterozygous atots/Df(ato) flies is not saturated at 25° and could potentially be enhanced at this temperature by second-site dominant modifier mutations (at least to the severity of the phenotype at 29°).
To examine whether the atots/Df(ato) rough eye phenotype at 25° (hereafter referred to as the ato phenotype) could be dominantly modified as described above, we first examined whether loss-of-function mutations in genes known to be involved in ato gene regulation could dominantly enhance this phenotype. The Hedgehog (hh) signal transduction pathway is involved in numerous cellular processes (INGHAM and MCMAHON 2001; STARK 2002; LUM and BEACHY 2004), including resolution of Atonal protein expression in the developing fly eye (BOROD and HEBERLEIN 1998; DOMINGUEZ 1999; WHITE and JARMAN 2000). We analyzed the effect of loss of a single copy of the hh gene on the ato phenotype at 25°. We found that a null mutation in the hh gene (hhAC, which alone has no heterozygous dominant adult eye phenotype) shows a dominant genetic enhancement of the ato phenotype (Figure 2J), indicating that this phenotype is indeed sensitive to loss-of-function mutations in cellular components that regulate Atonal protein expression.
We then tested whether the ato phenotype is sensitive to gain-of-function mutations that regulate Atonal protein expression as well. Increased nuclear translocation of MAP kinase, a downstream component of the Egfr pathway, has been shown to disrupt Atonal protein expression and spacing (KUMAR et al. 2003; VRAILAS et al. 2006), and increased Egfr expression directed within the morphogenetic furrow also shows decreased Atonal expression (CHEN and CHIEN 1999). Further, a gain-of-function mutation in Egfr (Egfr E1) results in decreased Atonal expression within the developing retina (JARMAN et al. 1995). Egfr E1, which alone has slight rough eye phenotype (Figure 2K), also shows a dominant genetic enhancement of the ato phenotype (Figure 2L). These results suggest that the ato phenotype is also sensitive to dominant enhancement by gain-of-function mutants as well.
A genetic screen for enhancers of the ato phenotype:
Using the ato phenotype at 25°, we performed a chemical (EMS) mutagenesis screen, examining a total of 22,151 flies for dominant enhancement of the phenotype. We recovered a total of 48 dominant enhancers, 15 of which separated into five total complementation groups (Table 1). Further, of the 48 enhancers we identified, only 1 of these enhancers was a mutation in the Star gene, which itself exhibits a dominant rough eye phenotype. This suggests that the multiallele complementation groups we identified in our screen most likely reflect genes directly involved in regulating atonal gene function and/or expression and are not additive or indirect effects from mutations in general modifiers of eye morphology.
|
The enhancers we identified in our genetic screen generally fell within one of three groups with regard to atonal expression: (1) those that differentially regulated atonal expression anterior and posterior to the morphogenetic furrow, (2) those that similarly regulated atonal expression anterior and posterior to the morphogenetic furrow, and (3) those that only regulated atonal expression posterior to the furrow.
Differential regulation of atonal expression—hedgehog (hh) and daughterless (da):
We mapped three of the third chromosome dominant enhancers of the ato phenotype to the hh locus (Table 1). hh is a segment polarity gene (NÜSSLEIN-VOLHARD and WIESCHAUS 1980) that encodes a secreted ligand required for Hedgehog pathway signaling and is involved in multiple developmental processes (INGHAM and MCMAHON 2001; LUM and BEACHY 2004), including the progression of the morphogenetic furrow (HEBERLEIN et al. 1993; MA et al. 1993) and the regulation of atonal gene expression in the developing fly retina (DOMINGUEZ 1999). Previous studies have shown that loss of hh signaling has opposite effects on atonal expression in the developing retina (DOMINGUEZ 1999).We mapped two of the second chromosome dominant enhancers of the ato phenotype to the da locus (Figure 3, J–L; Table 1). Both alleles of da moderately enhance the ato phenotype (Figure 3, J and K), and both alleles failed to complement two independent loss-of-function da mutations (daUX, da1, Table 1). We therefore tested for dominant enhancement of the ato phenotype with these independent loss-of-function da mutants and found that they also dominantly enhanced the ato phenotype (e.g., Figure 3L). We conclude that the two alleles we identified in our screen are also loss-of-function da alleles.
|
daughterless (da) encodes the only type I basic helix-loop-helix (bHLH) transcription factor in flies (SMITH and CRONMILLER 2001). Type II bHLH proteins generally exhibit a more restricted expression pattern, while the type I bHLH family of proteins (such as Daughterless) are more widely expressed throughout development (MASSARI and MURRE 2000). Type II bHLH proteins bind to type I bHLH transcription factors to form functional heterodimers to regulate target gene expression (JARMAN et al. 1993; KOPHENGNAVONG et al. 2000; MASSARI and MURRE 2000).
Mutations in da were previously shown to negatively regulate Atonal protein expression in the developing Drosophila retina (BROWN et al. 1996), but were also suggested to abolish R8 expression as well (BROWN et al. 1996). To determine the effects of da mutation on ato transcriptional regulation from the two different ato enhancer elements, we created loss-of-function homozygous somatic da mutant clones (XU and RUBIN 1993) and analyzed ato-lacZ reporter expression within these clones. We used a da null allele, daUX, and the eyeless:Flip specific recombinase to generate clones in the developing retina. In these clones, we observed expanded Atonal protein expression posterior to the morphogenetic furrow (arrows in Figure 4, A and B). We next analyzed atonal transcriptional regulation from the 3' genomic enhancer element within daUX mutant clones and found that the expression of this reporter is strongly increased and expanded in these clones posterior to the morphogenetic furrow (Figure 4, C and D). Analysis of atonal transcriptional regulation from the 5' genomic enhancer element showed the opposite effect, with nearly a complete loss of expression of atonal transcription within the intermediate groups and single R8 nuclei (Figure 4, E and F). Taken together, these results suggest that da gene function is differentially required for atonal transcriptional regulation, negatively regulating atonal transcription at the 3' atonal genomic enhancer, while simultaneously positively regulating atonal transcription at the 5' atonal genomic enhancer.
|
Similar regulation of atonal expression—lilliputian (lilli):
We mapped two of the second chromosome dominant enhancers of the ato phenotype to the lilli locus (Figure 3, B and C; Table 1). Both alleles show moderate-to-strong enhancement of the ato phenotype (e.g., Figure 3B), and both alleles failed to complement Bloomington Stock Collection Deficiency Df(2L)JS17, which deletes the lilliputian gene. Both alleles also failed to complement four independent loss-of-function lilli mutations (lilliXS407, lilliA17-2, lilliXS575, and lilliS35) (NEUFELD et al. 1998b; TANG et al. 2001). We therefore tested for dominant enhancement of the ato phenotype with these independent loss-of-function lilli mutants and found that all four alleles also dominantly enhanced the ato phenotype, although not as severely as the two we recovered in our screen (e.g., Figure 3C). We therefore concluded that these two mutants were alleles of lilliputian (lilliGD17 and lilliAG5), and that both behave genetically as loss-of-function mutants. Further, we conclude that it is loss-of-function at the lilli locus, and not at a potential second site, that is associated with the enhancement of the ato phenotype in these experiments.We analyzed atonal transcriptional regulation from both the 3' and 5' atonal genomic enhancer elements and found that transcription from both of these elements is reduced in homozygous lilli mutant clones (data not shown), suggesting that lilli gene function is positively required for ato transcriptional regulation within and posterior to the morphogenetic furrow at both the 3' and 5' atonal genomic enhancers. Characterization of the significance of this interaction will be described elsewhere (G. DISTEFANO and D. MARENDA, unpublished results).
kismet (kis):
We mapped four of the second chromosome dominant enhancers of the ato phenotype to the kis locus (Figure 3, D–F; Table 1). All four alleles show a mild enhancement of the ato phenotype (e.g., Figure 3D), and all four alleles failed to complement Exelixis Deficiency Df(2L)ED19, which deletes the kismet gene. All four alleles also failed to complement two independent loss-of-function kis mutations (kis1 and kisk13416) (KENNISON and TAMKUN 1988; ROCH et al. 1998). We tested for dominant enhancement of the ato phenotype with these independent loss-of-function kis mutants, and found that these two alleles also dominantly enhanced the ato phenotype (Figure 3, E and F). We therefore concluded that these four mutants were alleles of kismet (kisLM27, kisEC1, kisAS21, and kisAO9), and all behave genetically as loss-of-function mutants. Further, we conclude that it is loss-of-function at the kis locus, and not at a potential second site, that is associated with the enhancement of the ato phenotype in these experiments.kismet was initially identified in a screen for suppressors of a dominant homeotic phenotype associated with Polycomb (KENNISON and TAMKUN 1988) and has critical functions in embryonic development and segmentation (DAUBRESSE et al. 1999; SRINIVASAN et al. 2005). kis encodes multiple nuclear proteins that are related to chromatin remodeling factors and are largely associated with transcriptionally active chromatin (SRINIVASAN et al. 2005). In the Drosophila eye, mutations in kismet were recovered as enhancers of a gain-of-function kinase suppressor of Ras (ksr) rough eye phenotype (THERRIEN et al. 2000).
To better understand how kismet function is required for atonal expression in the developing retina, we first analyzed Kismet protein expression in developing third larval instar retinas. Using an antibody that is specific to the long form of the Kismet protein, Kismet-L, we detected ubiquitous Kismet expression in developing third instar retinas (Figure 5A). Kismet is expressed anterior to the morphogenetic furrow (Figure 5A), within the furrow (arrowhead in Figure 5B) and within developing photoreceptor cells posterior to the furrow (arrow in Figure 5B). Kismet is also expressed in later developing structures, including cone cells (arrow in Figure 5C). Thus, Kismet expression matches that of a protein that may be generally required for multiple events in Drosophila eye development and not specific to atonal expression within or posterior to the morphogenetic furrow.
|
To further characterize which phase in eye development kis gene function is required, we created loss-of-function homozygous somatic kis mutant clones. We first analyzed Kismet protein expression within these clones. In kisLM27 homozygous mutant clones, Kismet protein is absent from the mutant tissue (Figure 5, D–F), indicating that this particular allele is a protein null. This was also true for kisEC1 homozygous mutant clones (data not shown). We analyzed Atonal protein expression within kisLM27 homozygous mutant clones and found that Atonal expression is markedly reduced (Figure 5, G–I). Atonal expression was most severely reduced in the broad stripe of Atonal expression anterior to the morphogenetic furrow as well as within the intermediate groups, (arrows in Figure 5G). Some Ato expression within single R8s still remained (arrow in Figure 5I). Similar results were obtained with kisEC1 homozygous mutant clones (data not shown). These data suggest that kis gene function is required for normal Atonal protein expression.
The Kismet protein is a transcription factor, thought to play a role in altering gene expression through changes in chromatin structure (SRINIVASAN et al. 2005). Therefore, we next looked at atonal transcriptional regulation at both the 3' and 5' regulatory elements within kis mutant tissue. In kisLM27 homozygous mutant clones, we found that the amount of β-galactosidase protein expressed from the 3' ato-lacZ element was strongly reduced (Figure 5, J–L). Similarly, we found that the amount of β-galactosidase protein expressed from the 5' ato-lacZ element was also strongly reduced (Figure 5, M–O). Taken together, these data strongly suggest that kis gene function is normally required for atonal transcriptional activation and/or maintenance at both the 3' and 5' atonal gene enhancer elements.
On the basis of Kismet protein expression within the developing eye, we sought to further analyze the role of kis gene function in other phases of eye development, both anterior and posterior to the morphogenetic furrow. Unlike homozygous somatic mutant clones in genes required for cell division and cell growth, homozygous mutant kis clones are not small and scarce within the developing retinas (Figure 5D), suggesting that kis gene function is not required anterior to the morphogenetic furrow for cell division and/or growth functions. To further analyze gene expression anterior to the furrow, we examined the expression of the Hairy protein. Anterior to the furrow, the expression of hairy (h) marks the "preproneural domain" (GREENWOOD and STRUHL 1999), which is expressed just prior to atonal expression in the developing retina. Within homozygous mutant kis clones, h expression was normal (Figure 6, A–C), suggesting that kis function is also not required for patterning events immediately ahead of the morphogenetic furrow. kis loss-of-function clones were previously reported to have no effect on photoreceptor differentiation posterior to the morphogenetic furrow (JANODY et al. 2004). Consistent with these data, we also observe no significant effect on ELAV expression within kis mutant clones located posterior to the morphogenetic furrow (data not shown), suggesting that kis gene function is also not required for photoreceptor differentiation posterior to the morphogenetic furrow.
|
To further determine if kis function is restricted to events occurring within and near the morphogenetic furrow, we analyzed the expression of other proteins expressed within and near the furrow, including the expression of Daughterless and Scabrous. Daughterless protein was previously shown to be expressed throughout the eye disc, with stronger expression within the morphogenetic furrow (BROWN et al. 1996). In homozygous mutant kis clones, we observed that Daughterless expression was reduced, but not absent (Figures 6, D–F). Scabrous expression is a target of Atonal and is also expressed within and near the intermediate groups in the furrow (BAKER et al. 1990; MLODZIK et al. 1990; FRANKFORT and MARDON 2002). In homozygous mutant kis clones, we observed that like Daughterless expression, Scabrous expression was also reduced, but not absent (Figure 6, G–I). Taken together, these data suggest that kismet gene function is restricted to regulating the expression of factors within and near the morphogenetic furrow of the developing larval retina.
The Kismet protein belongs to the trithorax group of transcriptional regulators (DAUBRESSE et al. 1999), which include trithorax, kohtalo, skuld, and members of the Brahma complex (brm, osa, snr1, and moira) (TAMKUN et al. 1992; DINGWALL et al. 1995; ELFRING et al. 1998; COLLINS et al. 1999). Mutations in brm, snr1, and osa all affect eye development (TREISMAN et al. 1997; BRUMBY et al. 2002; MARENDA et al. 2003), and mutations in the trithorax genes trithorax, brahma, kohtalo, and skuld were recently identified in a mosaic genetic screen used to identify genes required for retinal patterning (JANODY et al. 2004). Our identification of kis in our genetic screen led us to hypothesize that other trithorax group genes might also be involved in regulating Atonal expression. To test this possibility, we created clones in the developing retina for loss-of-function mutations in brahma (brmT485), osa (osa308), snr1 (snr1R3), and trithorax (trxE2).
brm mutant clones were very small, consistent with what has been previously reported (JANODY et al. 2004). Analysis of multiple small brm mutant clones showed a complex regulation on Atonal protein expression (Figure 7, A–F). Within brm mutant clones in and near the morphogenetic furrow, Atonal protein expression was unaffected in both the broad stripe of expression and in single R8 nuclei as well (arrows in Figure 7, A–C). However, within
10% of brm mutant clones posterior to the morphogenetic furrow, Atonal protein expression in single R8 nuclei was inappropriately expressed (arrows in Figure 7, D–F). For both osa and snr1 mutant clones, Atonal protein expression was unaffected (arrowheads in Figure 7, G–L), suggesting that although these genes are required for retinal patterning, they are not significantly affecting Atonal expression within the morphogenetic furrow. We did observe loss of Atonal protein expression in clones of cells mutant for trx (Figure 7, M–O). Within trx mutant clones, Atonal expression is absent at both the broad stripe as well as within single R8 nuclei. Taken together, our results suggest that of the trithorax group proteins we tested, only Kismet and Trithorax are required for Atonal expression in the morphogenetic furrow.
|
Regulation of Atonal expression at a single enhancer—roughened eye (roe):
We mapped four of the third chromosome dominant enhancers of the ato phenotype to the roe locus (Figure 3, G–I; Table 1). Mutations in roe are strong enhancers of the ato phenotype (Figure 3, G–I). Each of these alleles was on a chromosome that also contained the Df(ato) deletion, and these flies were crossed to a small deletion (rn16, ST PIERRE et al. 2002) that removes the C terminus of the rotund gene and the entire roughened eye gene. These adults produced a small eye phenotype that is stronger than the ato eye phenotype used in our screen (compare Figure 3A and G–I to Figure 8, C and D). Heteroallelic mutant combinations of the roughened eye (roe) gene produce viable adults with small rough eyes (Figure 8, A and B) (ST PIERRE et al. 2002). We therefore concluded that the four alleles that made up this complementation group were alleles of the roughened eye gene (roeSM8, roeBM10, roeKM29, roeKK16; Table 1).
|
To better understand how Roe protein function is required for atonal expression in the developing retina, we raised an antibody to the N-terminal portion of the Roe protein and analyzed Roe protein expression in developing retinas. roe mRNA was previously reported as being expressed within a band of 4–6 cells within the morphogenetic furrow (ST PIERRE et al. 2002). To more precisely define the area within the eye disc in which the Roe protein is expressed, we costained wild-type developing retinas for both Roe and Atonal protein expression (Figure 8, E and F). Consistent with previous reports, we also detected Roe expression within a band of 4–6 cells within the morphogenetic furrow (Figure 8E). Roe protein expression is predominantly nuclear. Interestingly, Roe expression first appears just behind (posterior to) the broad stripe of Atonal expression that is anterior to and within the morphogenetic furrow (arrowhead in Figure 8F). Roe protein first colocalizes both within the first column of nascent R8 nuclei immediately posterior to the broad stripe of Atonal expression (black arrow in Figure 8F) as well as within those nuclei surrounding this R8 cell. Roe protein then appears to be solely expressed within those nuclei immediately surrounding the second column of R8 cells (blue arrow in Figure 8F) and is no longer expressed near the third column of R8 cells (red arrow in Figure 8F).
On the basis of expression of the Roe protein, we predicted that Roe protein function with regard to atonal expression may be limited to the 5' atonal regulatory element. As an initial test of this hypothesis, we analyzed Atonal protein expression in a strong roe loss-of-function background that had been previously used to analyze loss of roe function in the developing retina (roe3/rn16, Figure 8B) (ST PIERRE et al. 2002). This genetic background includes both a deletion of the rotund locus that removes function for both the rotund and roe genes (rn16) and also a point mutation that specifically removes roe gene function alone (roe3) (ST PIERRE et al. 2002). In this background, Atonal protein expression is reduced, but not absent. Atonal protein is still present in a broad stripe anterior to the furrow (Figure 8H), however, refinement of Atonal into single R8 nuclei is nearly absent (compare Figure 8, G and H), suggesting that mutation of the roe gene specifically affects atonal expression from the 5' regulatory element. To verify this, we analyzed atonal transcriptional regulation at both the 3' and 5' regulatory elements within the roe loss-of-function background (Figure 8, I–L). ato transcription as assayed from the 3' atonal regulatory element appears normal in roe loss-of-function eye discs (Figure 8, I and J). However, transcription from the 5' atonal regulatory element is severely reduced (Figure 8, K and L), and ato transcription in single R8 cells is absent, consistent with what we observe with Atonal protein expression in this background. When taken together, these results suggest that the Roe protein is necessary for atonal transcriptional regulation specifically at the 5' atonal regulatory element within the morphogenetic furrow, and that in roe mutants, single R8 cells are not specified.
Differential regulation of atonal transcription:
In our screen, we identified mutations in both the hedgehog and daughterless genes as enhancers of our loss-of-function atonal phenotype. Both of these mutants alter Atonal protein expression differentially anterior to the morphogenetic furrow as compared to posterior to the morphogenetic furrow. Regulation of atonal expression by the hedgehog pathway is well described (DOMINGUEZ 1999; SUZUKI and SAIGO 2000; WHITE and JARMAN 2000; LIM et al. 2008). LIM et al. (2008) describe recent evidence for Daughterless-mediated atonal expression in the developing retina that may further explain the results we have observed in our study.We have shown that daughterless function is required to repress atonal transcription at the 3' atonal enhancer. Importantly, this repression is only required for 3' atonal transcription posterior to the morphogenetic furrow, as 3' atonal enhancer expression is not upregulated anterior to the furrow in da mutant clones (Figure 4). At the 5' atonal enhancer, daughterless function is required to promote atonal transcription. Atonal forms heterodimers with Daughterless (JARMAN et al. 1993), and it is this heterodimerization that is required for bHLH protein function (KOPHENGNAVONG et al. 2000; MASSARI and MURRE 2000). Since the 5' atonal enhancer elements undergo autoregulation (SUN et al. 1998), this suggests that Daughterless protein function at the 5' element may play an important role in this autoregulation. However, our data suggest that posterior to the morphogenetic furrow, while the Daughterless protein is required to form heterodimers with Atonal to positively regulate atonal transcription from the 5' atonal enhancer, it is simultaneously required to transcriptionally repress atonal expression at the 3' atonal enhancer element. LIM et al. (2008) have recently suggested that Daughterless forms homodimers and/or heterodimers with unknown bHLH proteins to repress atonal expression. Our data fit well with this model of atonal regulation and suggest that Daughterless homodimers may be required in cells surrounding developing R8 photoreceptors to repress atonal transcription from the 3' atonal enhancer element.
Similar regulation of atonal transcription:
In our screen, we identified mutations in both the lilliputian and kismet genes as enhancers or our loss-of-function atonal phenotype. Mutations in both of these genes have a similar effect on atonal transcriptional regulation at the two atonal enhancer elements, as each is required to promote atonal transcription at both enhancers. Interestingly, mutations in both of the human homologs of these genes are involved in forms of mental retardation. Mutation in Fmr2/AF4 gene family members (the human homolog of lilliputian) are involved in both acute lymphoblastic leukemia and FRAXE nonsyndromic X-linked mental retardation syndrome (GU et al. 1996; GU and NELSON 2003). Mutations in Chd7 (the human homolog of kismet) are estimated to be causative for nearly two-thirds of all CHARGE syndrome diagnoses (SANLAVILLE and VERLOES 2007), a rare, autosomal dominant disorder. Of further interest, patients with CHARGE syndrome also display eye and ear abnormalities, including coloboma, a symptom that is also attributed to mutations in the mammalian homolog of the hedgehog gene (SCHIMMENTI et al. 2003; FUERST et al. 2007). The human homolog of atonal (math5) is expressed and critically required for both proper retinal and auditory development (BROWN et al. 1998, 2001; WANG et al. 2001; YANG et al. 2003; LE et al. 2006; HUFNAGEL et al. 2007; SAUL et al. 2008) and thus may be a good candidate for a critical target gene that is disrupted in CHARGE syndrome.Recent analysis of Kismet protein on salivary gland chromosomes suggests that Kis plays a global role in transcription by Pol II (SRINIVASAN et al. 2005). Consistent with the idea of global transcription, we observe Kis staining in all cells of the developing Drosophila retina, suggesting that Kis would also play a role in global transcription in the eye. However, our analysis of kismet mutant clones suggests that kis gene function is limited to events occurring within and near the morphogenetic furrow. We observe effects on Atonal, Daughterless, and Scabrous protein expression within the furrow, but see no effects on marker expression within kis mutant clones either posterior or anterior to the furrow. We have analyzed Kis protein expression within these clones and found that it is absent, suggesting that these mutants are effectively protein nulls within this tissue, and thus the normal expression of these markers is not likely due to residual kismet gene expression. kis mutants also show a limited number of phenotypes within Drosophila embryos (DAUBRESSE et al. 1999). Taken together, these data suggest that (1) there may be redundant factors within the developing retina that can compensate for kis gene function within cells posterior and anterior to the furrow or (2) that Kismet protein function is only required in cells within and near the furrow, and does not have a function in areas outside these cells.
Members of the trithorax group of proteins appear to have a variety of functions within the developing Drosophila retina (JANODY et al. 2004). Further, many of the trithorax genes required for specific cellular processes in the eye have a ubiquitous expression pattern in the eye (KUZIN et al. 1994; TREISMAN et al. 1997; JANODY et al. 2003; ZRALY et al. 2003), much like the Kismet protein. This expression data might suggest a dynamic functional and developmental regulation of these factors. In support of this, we have analyzed Kismet protein expression within loss-of-function genetic backgrounds of developmental signals known to regulate eye development and Atonal expression, including the Notch and Hedgehog pathways, as well as in daughterless and eyes absent mutants and find no difference in Kismet expression in any of these mutants (supplemental Figure 1). Thus, the rapid transitions in gene expression between different phases of retinal development (anterior and posterior to the furrow) must involve functional regulation of these ubiquitously expressed transcription factors and not the regulation of their gene expression within different phases.
While mutations in kis show no affect on photoreceptor differentiation posterior to the furrow, or on patterning events anterior to the furrow, mutations in other ubiquitously expressed trithorax group genes show differential effects in these areas. Mutations in trithorax group genes brahma, moira, skd, and kto all show loss of photoreceptor differentiation posterior to the furrow, while mutations in the trithorax group gene osa show less severe effects on photoreceptor differentiation in this area of the retina (JANODY et al. 2004). Ahead of the furrow, brm and osa mutants have no effect on the expression of the anterior markers hth, ey, and tsh, while mutations in trx, skd, and kto all significantly affect these markers (JANODY et al. 2004). Further, while we do not observe any effect on Atonal expression in the furrow within brm, osa, or snr1 mutant clones, we do see decreased Atonal expression in trx mutant clones. Immediately ahead of the furrow, within the preproneural domain, only trx, kto, and skd show effects on the markers hairy and eya, and only trx mutants showed an effect on dac expression (JANODY et al. 2004). Similarly, recent studies have shown atonal expression is affected in clones mutant for skd and kto (LIM et al. 2007). Within skd and kto clones, single R8 neurons are selected even without fully resolved intermediate groups (LIM et al. 2007), an occurrence that also happens in kis mutant clones (Figure 5).
Taken together with our results, these data now begin to separate specific functions within the trithorax group of proteins into a developmental requirement for specific events during retinal development. Thus, ahead of the furrow, only trx, skd, and kto appear to be required for specific transcriptional regulation of the targets tested so far. Within the furrow, trx, skd, kto, and kis all show an effect on atonal expression, while brm, osa, and snr1 do not. Finally, posterior to the furrow, trithorax group members brm, moira, osa, skd, kto, and trx are all required for photoreceptor differentiation.
Transcriptional regulation in the developing retina requires rapid changes in gene expression as the morphogenetic furrow moves across the eye disc (MOSES 1991, 2003; KUMAR and MOSES 1997). The movement of the morphogenetic furrow allows for a new column of photoreceptor cells to be specified roughly every 2 hr for uniform movement of the morphogenetic furrow (CAMPOS-ORTEGA and HOFBAUER 1977), and every 70 min for nonuniform movement (BASLER and HAFEN 1989). Thus, the developmental regulation of different target-specific transcription factors must be tightly controlled, as cell type specific transcription will rapidly change as the morphogenetic furrow moves across the retina. Regulated changes in chromatin structure must therefore also be tightly regulated, as the morphogenetic furrow moves across the retina. The different requirement for trithorax group proteins ahead of, within, and posterior to the morphogenetic furrow may reflect differential changes in chromatin structure necessary to accommodate rapid changes in transcription during retinal development. Thus, these different transcriptional events may be anticipated by cells in regions of the developing retina before the morphogenetic furrow has reached these cells.
Expression of atonal at only one enhancer element:
In our screen, we identified mutations in the roughed eye gene as an enhancer or our loss-of-function atonal phenotype. We show that Roe protein expression is restricted to the cells expressing the 5' atonal regulatory element marker within morphogenetic furrow, specifically colocalized within and surrounding the first column of nascent R8 cells. These data suggest that roe gene function is required for the proper formation of R8 nuclei and is consistent with Roe protein expression colocalizing with Atonal protein expression in the R8 cells. However, Roe protein is also present in nuclei surrounding the nascent R8 cells. It has been previously shown that Delta protein expression is disrupted in roe mutant retinas (ST PIERRE et al. 2002), moving from a punctate expression pattern to a more diffuse pattern. Posterior to the furrow, Delta expression becomes restricted to the R8 cell, and this activates the Notch pathway in surrounding cells to repress atonal transcription (LEE et al. 1996; LI and BAKER 2001; DOROQUEZ and REBAY 2006). Thus, if the Roe protein surrounding the R8 cells functions to repress Delta expression within these cells, loss of Roe may lead to increased Delta expression within these cells and thus cause the Notch pathway to become activated in the R8 cell itself, repressing atonal transcription.In the developing retina, the restricted expression of cell-specific factors (such as roughened eye) is vital to the proper development of a specific subset of retinal precursor cells. However, the broader transcriptional regulation of these cell-specific transcription factors by ubiquitous transcription factors (such as kismet) remains less clear. Our results presented here suggest that although these factors are expressed ubiquitously, many of them have very specific functions in distinct phases of retinal development. These results provide additional insights into the complex regulation of atonal expression in the developing retina.
AGNEL, M., S. KERRIDGE, C. VOLA and R. GRIFFIN-SHEA, 1989 Two transcripts from the rotund region of Drosophila show positional specificities in imaginal disc tissues. Genes Dev. 3: 85–95.
ASHBURNER, M., 1989 Drosophila: A Laboratory Handbook. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY.
BAKER, N. E., M. MLODZIK and G. M. RUBIN, 1990 Spacing differentiation in the developing Drosophila eye: a fibrinogen-related lateral inhibitor encoded by scabrous. Science 250: 1370–1377.
BAKER, N. E., and G. M. RUBIN, 1989 Effect on eye development of dominant mutations in Drosophila homologue of the EGF receptor. Nature 340: 150–153.[CrossRef][Medline]
BAKER, N. E., and G. M. RUBIN, 1992 Ellipse mutations in the Drosophila homologue of the EGF receptor affect pattern formation, cell division, and cell death in eye imaginal discs. Dev. Biol. 150: 381–396.[CrossRef][Medline]
BAKER, N. E., S. YU and D. HAN, 1996 Evolution of proneural atonal expression during distinct regulatory phases in the developing Drosophila eye. Curr. Biol. 6: 1290–1301.[CrossRef][Medline]
BASLER, K., and E. HAFEN, 1989 Dynamics of Drosophila eye development and temporal requirements of sevenless expression. Development 107: 723–731.
BELL, A. E., 1954 New mutants report. Drosoph. Inf. Serv. 28: 73.
BONINI, N. M., W. M. LEISERSON and S. BENZER, 1993 The eyes absent gene: genetic control of cell survival and differentiation in the developing Drosophila eye. Cell 72: 379–395.[CrossRef][Medline]
BOROD, E. R., and U. HEBERLEIN, 1998 Mutual regulation of decapentaplegic and hedgehog during the initiation of differentiation in the Drosophila retina. Dev. Biol. 197: 187–197.[CrossRef][Medline]
BROWN, N. L., S. KANEKAR, M. L. VETTER, P. K. TUCKER, D. L. GEMZA et al., 1998 Math5 encodes a murine basic helix-loop-helix transcription factor expressed during early stages of retinal neurogenesis. Development 125: 4821–4833.[Abstract]
BROWN, N. L., S. W. PADDOCK, C. A. SATTLER, C. CRONMILLER, B. J. THOMAS et al., 1996 daughterless is required for Drosophila photoreceptor cell determination, eye morphogenesis, and cell cycle progression. Dev. Biol. 179: 65–78.[CrossRef][Medline]
BROWN, N. L., S. PATEL, J. BRZEZINSKI and T. GLASER, 2001 Math5 is required for retinal ganglion cell and optic nerve formation. Development 128: 2497–2508.
BRUMBY, A. M., C. B. ZRALY, J. A. HORSFIELD, J. SECOMBE, R. SAINT et al., 2002 Drosophila cyclin E interacts with components of the Brahma complex. EMBO J. 21: 3377–3389.[CrossRef][Medline]
CAMPOS-ORTEGA, J. A., and A. HOFBAUER, 1977 Cell clones and pattern formation: on the lineage of photoreceptor cells in the compound eye of Drosophila. Roux's Arch. Dev. Biol. 181: 227–245.
CHEN, C.-K., and C.-T. CHIEN, 1999 Negative regulation of atonal in proneural cluster formation of Drosophila R8 photoreceptors. Proc. Natl. Acad. Sci. USA 96: 5055–5060.
COLLINS, R. T., T. FURUKAWA, N. TANESE and J. E. TREISMAN, 1999 Osa associates with the Brahma chromatin remodeling complex and promotes the activation of some target genes. EMBO J. 18: 7029–7040.[CrossRef][Medline]
DAUBRESSE, G., R. DEURING, L. MOORE, O. PAPOULAS, I. ZAKRAJSEK et al., 1999 The Drosophila kismet gene is related to chromatin-remodeling factors and is required for both segmentation and segment identity. Development 126: 1175–1187.[Abstract]
DINGWALL, A. K., S. J. BEEK, C. M. MCCALLUM, J. W. TAMKUN, G. V. KALPANA et al., 1995 The Drosophila snr1 and brm proteins are related to yeast SWI/SNF proteins and are components of a large protein complex. Mol. Biol. Cell 6: 777–791.[Abstract]
DOMINGUEZ, M., 1999 Dual role for Hedgehog in the regulation of the proneural gene atonal during ommatidia development. Development 126: 2345–2353.[Abstract]
DOROQUEZ, D. B., and I. REBAY, 2006 Signal integration during development: mechanisms of EGFR and Notch pathway function and cross-talk. Crit. Rev. Biochem. Mol. Biol. 41: 339–385.[CrossRef][Medline]
ELFRING, L. K., C. DANIEL, O. PAPOULAS, R. DEURING, M. SARTE et al., 1998 Genetic analysis of brahma: the Drosophila homolog of the yeast chromatin remodeling factor SWI2/SNF2. Genetics 148: 251–265.
FRANKFORT, B. J., and G. MARDON, 2002 R8 development in the Drosophila eye: a paradigm for neural selection and differentiation. Development 129: 1295–1306.[Medline]
FRANKFORT, B. J., R. NOLO, Z. ZHANG, H. BELLEN and G. MARDON, 2001 senseless Repression of rough is required for R8 photoreceptor differentiation in the developing Drosophila eye. Neuron 32: 403–414.[CrossRef][Medline]
FREEMAN, M., 1997 Cell determination strategies in the Drosophila eye. Development 124: 261–270.[Abstract]
FREEMAN, M., 1998 Complexity of EGF receptor signaling revealed in Drosophila. Curr. Opin. Genet. Dev. 8: 407–411.[CrossRef][Medline]
FUERST, P. G., S. M. RAUCH and R. W. BURGESS, 2007 Defects in eye development in transgenic mice overexpressing the heparan sulfate proteoglycan agrin. Dev. Biol. 303: 165–180.[CrossRef][Medline]
GREENWOOD, S., and G. STRUHL, 1999 Progression of the morphogenetic furrow in the Drosophila eye: the roles of Hedgehog, Decapentaplegic and the Raf pathway. Development 126: 5795–5808.[Abstract]
GU, Y., Y. SHEN, R. A. GIBBS and D. L. NELSON, 1996 Identification of FMR2, a novel gene associated with the FRAXE CCG repeat and CpG island. Nat. Genet. 13: 109–113.[CrossRef][Medline]
GU, Y., and D. L. NELSON, 2003 FMR2 function: insight from a mouse knockout model. Cytogenet. Genome Res. 100: 129–139.[CrossRef][Medline]
HASSAN, B. A., and H. J. BELLEN, 2000 Doing the MATH: Is the mouse a good model for fly development? Genes Dev. 14: 1852–1865.
HEBERLEIN, U., T. WOLFF and G. M. RUBIN, 1993 The TGFβ homolog dpp and the segment polarity gene hedgehog are required for propagation of a morphogenetic wave in the Drosophila retina. Cell 75: 913–926.[CrossRef][Medline]
HIGSON, T. S., J. E. TESSIATORE, S. A. BENNETT, R. C. DERK and M. A. KOTARSKI, 1993 The molecular organization of the Star/asteroid region, a region necessary for proper eye development in Drosophila melanogaster. Genome 36: 356–366.[Medline]
HSIUNG, F., and K. MOSES, 2002 Retinal development in Drosophila: specifying the first neuron. Hum. Mol. Genet. 11: 1207–1214.
HUFNAGEL, R. B., A. N. RIESENBERG, S. M. SAUL and N. L. BROWN, 2007 Conserved regulation of Math5 and Math1 revealed by Math5-GFP transgenes. Mol. Cell. Neurosci. 36: 435–448.[Medline]
HUTCHESON, D. A., and M. L. VETTER, 2001 The bHLH factors Xath5 and XNeuroD can upregulate the expression of Xbrn3d, a POU-homeodomain transcription factor. Dev. Biol. 232: 327–338.[CrossRef][Medline]
INGHAM, P. W., and A. P. MCMAHON, 2001 Hedgehog signaling in animal development: paradigms and principles. Genes Dev. 15: 3059–3087.
JANODY, F., J. D. LEE, N. JAHREN, D. J. HAZELET, A. BANLALI et al., 2004 A mosaic genetic screen reveals distinct roles for trithorax and Polycomb group genes in Drosophila eye development. Genetics 166: 187–200.
JANODY, F., Z. MARTIROSYAN, A. BENLALI and J. E. TREISMAN, 2003 Two subunits of the Drosophila mediator complex act together to control cell affinity. Development 130: 3691–3701.
JARMAN, A. P., Y. GRAU, L. Y. JAN and Y. N. JAN, 1993 atonal is a proneural gene that directs chordotonal organ formation in the Drosophila peripheral nervous system. Cell 73: 1307–1321.[CrossRef][Medline]
JARMAN, A. P., E. H. GRELL, L. ACKERMAN, L. Y. JAN and Y. N. JAN, 1994 atonal is the proneural gene for Drosophila photoreceptors. Nature 369: 398–400.[CrossRef][Medline]
JARMAN, A. P., Y. SUN, L. Y. JAN and Y. N. JAN, 1995 Role of the proneural gene, atonal, in formation of the Drosophila chordotonal organs and photoreceptors. Development 121: 2019–2030.[Abstract]
KENNISON, J. A., and J. W. TAMKUN, 1988 Dosage-dependent modifiers of polycomb and antennapedia mutations in Drosophila. Proc. Natl. Acad. Sci. USA 85: 8136–8140.
KOPHENGNAVONG, T., J. E. MICHNOWICZ and T. K. BLACKWELL, 2000 Establishment of distinct MyoD, E2A, and twist DNA binding specificities by different basic region-DNA conformations. Mol. Cell. Biol. 20: 261–272.
KUMAR, J., and K. MOSES, 1997 Transcription factors in eye development: A gorgeous mosaic? Genes Dev. 11: 2023–2028.
KUMAR, J. P., F. HSIUNG, M. POWERS and K. MOSES, 2003 Nuclear translocation of activated MAP kinase is developmentally regulated in the developing Drosophila eye. Development 130: 3703–3714.
KUZIN, B., S. TILLIB, Y. SEDKOV, L. MIZROKHI and A. MAZO, 1994 The Drosophila trithorax gene encodes a chromosomal protein and directly regulates the region-specific homeotic gene fork head. Genes Dev. 8: 2478–2490.
LE, T. T., E. WROBLEWSKI, S. PATEL, A. N. RIESENBERG and N. L. BROWN, 2006 Math5 is required for both early retinal neuron differentiation and cell cycle progression. Dev. Biol. 295: 764–778.[CrossRef][Medline]
LEE, E.-C., X. HU, S.-Y. YU and N. E. BAKER, 1996 The scabrous gene encodes a secreted glycoprotein dimer and regulates proneural development in Drosophila eyes. Mol. Cell. Biol. 16: 1179–1188.[Abstract]
LEE, J. J., D. P. VON KESSLER, S. PARKS and P. A. BEACHY, 1992 Secretion and localized transcription suggest a role in positional signaling for products of the segmentation gene hedgehog. Cell 71: 33–50.[CrossRef][Medline]
LEWIS, E. B., 1945 The relation of repeats to position effect in Drosophila melanogaster. Genetics 30: 137–166.
LI, Y., and N. E. BAKER, 2001 Proneural enhancement by Notch overcomes Suppressor-of-Hairless repressor function in the developing Drosophila eye. Curr. Biol. 11: 330–338.[CrossRef][Medline]
LIM, J., O. K. LEE, Y. C. HSU, A. SINGH and K. W. CHOI, 2007 Drosophila TRAP230/240 are essential coactivators for Atonal in retinal neurogenesis. Dev. Biol. 308: 322–330.[CrossRef][Medline]
LIM, J., H. JAFAR-NEJAD, Y. C. HSU and K. W. CHOI, 2008 Novel function of the class I bHLH protein Daughterless in the negative regulation of proneural gene expression in the Drosophila eye. EMBO Rep. (in press).
LUM, L., and P. A. BEACHY, 2004 The Hedgehog response network: sensors, switches, and routers. Science 304: 1755–1759.
MA, C., Y. ZHOU, P. A. BEACHY and K. MOSES, 1993 The segment polarity gene hedgehog is required for progression of the morphogenetic furrow in the developing Drosophila eye. Cell 75: 927–938.[CrossRef][Medline]
MA, C., H. LIU, Y. ZHOU and K. MOSES, 1996 Identification and characterization of autosomal genes that interact with glass in the developing Drosophila eye. Genetics 142: 1199–1213.[Abstract]
MARENDA, D. R., C. B. ZRALY, Y. FENG, S. EGAN and A. K. DINGWALL, 2003 The Drosophila SNR1 (SNF5/INI1) subunit directs essential developmental functions of the Brahma chromatin remodeling complex. Mol. Cell. Biol. 23: 289–305.
MASSARI, M. E., and C. MURRE, 2000 Helix-loop-helix proteins: regulators of transcription in eucaryotic organisms. Mol. Cell. Biol. 20: 429–440.
MLODZIK, M., N. E. BAKER and G. M. RUBIN, 1990 Isolation and expression of scabrous, a gene regulating neurogenesis in Drosophila. Genes Dev. 4: 1848–1861.
MOLLEREAU, B., and P. M. DOMINGOS, 2005 Photoreceptor differentiation in Drosophila: from immature neurons to functional photoreceptors. Dev. Dyn. 232: 585–592.[CrossRef][Medline]
MOSES, K., 1991 The role of transcription factors in the developing Drosophila eye. Trends Genet. 7: 250–255.[Medline]
MOSES, K., 2003 Drosophila eye: progressive neural development, in Encyclopedia of Life Sciences. John Wiley & Sons, Chichester, UK.
MULLER, D., S. J. KUGLER, A. PREISS, D. MAIER and A. C. NAGEL, 2005 Genetic modifier screens on Hairless gain-of-function phenotypes reveal genes involved in cell differentiation, cell growth and apoptosis in Drosophila melanogaster. Genetics 171: 1137–1152.
NEUFELD, T. P., A. F. DE LA CRUZ, L. A. JOHNSTON and B. A. EDGAR, 1998a Coordination of growth and cell division in the Drosophila wing. Cell 93: 1183–1193.[CrossRef][Medline]
NEUFELD, T. P., A. H. TANG and G. M. RUBIN, 1998b A genetic screen to identify components of the sina signaling pathway in Drosophila eye development. Genetics 148: 277–286.
NEWSOME, T. P., B. ASLING and B. J. DICKSON, 2000 Analysis of Drosophila photoreceptor axon guidance in eye-specific mosaics. Development 127: 851–860.[Abstract]
NÜSSLEIN-VOLHARD, C., and E. WIESCHAUS, 1980 Mutations affecting segment number and polarity in Drosophila. Nature 287: 795–801.[CrossRef][Medline]
PERRON, M., and W. A. HARRIS, 2000 Determination of vertebrate retinal progenitor cell fate by the Notch pathway and basic helix-loop-helix transcription factors. Cell. Mol. Life Sci. 57: 215–223.[CrossRef][Medline]
PERRON, M., S. KANEKAR, M. L. VETTER and W. A. HARRIS, 1998 The genetic sequence of retinal development in the ciliary margin of the Xenopus eye. Dev. Biol. 199: 185–200.[CrossRef][Medline]
READY, D. F., T. E. HANSON and S. BENZER, 1976 Development of the Drosophila retina, a neurocrystalline lattice. Dev. Biol. 53: 217–240.[CrossRef][Medline]
ROCH, F., F. SERRAS, F. J. CIFUENTES, M. COROMINAS, B. ALSINA et al., 1998 Screening of larval/pupal P-element induced lethals on the second chromosome in Drosophila melanogaster: clonal analysis and morphology of imaginal discs. Mol. Gen. Genet. 257: 103–112.[Medline]
SANLAVILLE, D., and A. VERLOES, 2007 CHARGE syndrome: an update. Eur. J. Hum. Genet. 15: 389–399.[CrossRef][Medline]
SAUL, S. M., J. A. BRZEZINSKI, IV, R. A. ALTSCHULER, S. E. SHORE, D. D. RUDOLPH et al., 2008 Math5 expression and function in the central auditory system. Mol. Cell. Neurosci. 37: 153–169.[Medline]
SCHIMMENTI, L. A., J. DE LA CRUZ, R. A. LEWIS, J. D. KARKERA, G. S. MANLIGAS et al., 2003 Novel mutation in sonic hedgehog in non-syndromic colobomatous microphthalmia. Am. J. Med. Genet. A 116A: 215–221.
SMITH, J. E., III, and C. CRONMILLER, 2001 The Drosophila daughterless gene autoregulates and is controlled by both positive and negative cis regulation. Development 128: 4705–4714.
SRINIVASAN, S., J. A. ARMSTRONG, R. DEURING, I. K. DAHLSVEEN, H. MCNEILL et al., 2005 The Drosophila trithorax group protein Kismet facilitates an early step in transcriptional elongation by RNA polymerase II. Development 132: 1623–1635.
ST PIERRE, S. E., M. I. GALINDO, J. P. COUSO and S. THOR, 2002 Control of Drosophila imaginal disc development by rotund and roughened eye: differentially expressed transcripts of the same gene encoding functionally distinct zinc finger proteins. Development 129: 1273–1281.
STARK, D. R., 2002 Hedgehog signalling: pulling apart Patched and Smoothened. Curr. Biol. 12: R437–R439.[Medline]
SUN, Y., L. Y. JAN and Y. N. JAN, 1998 Transcriptional regulation of atonal during development of the Drosophila peripheral nervous system. Development 125: 3731–3740.[Abstract]
SUZUKI, T., and K. SAIGO, 2000 Transcriptional regulation of atonal required for Drosophila larval eye development by concerted action of eyes absent, sine oculis and hedgehog signaling independent of fused kinase and cubitus interruptus. Development 127: 1531–1540.[Abstract]
TAMKUN, J. W., R. DEURING, M. P. SCOTT, M. KISSINGER, A. M. PATTATUCCI et al., 1992 brahma: a regulator of Drosophila homeotic genes structurally related to the yeast transcriptional activator SNF2/SWI2. Cell 68: 561–572.[CrossRef][Medline]
TANG, A. H., T. P. NEUFELD, G. M. RUBIN and H. A. MULLER, 2001 Transcriptional regulation of cytoskeletal functions and segmentation by a novel maternal pair-rule gene, lilliputian. Development 128: 801–813.[Abstract]
THERRIEN, M., D. K. MORRISON, A. M. WONG and G. M. RUBIN, 2000 A genetic screen for modifiers of a kinase suppressor of Ras-dependent rough eye phenotype in Drosophila. Genetics 156: 1231–1242.
TIO, M., and K. MOSES, 1997 The Drosophila TGF
homolog Spitz acts in photoreceptor recruitment in the developing retina. Development 124: 343–351.[Abstract]
TOMLINSON, A., and D. F. READY, 1987 Neuronal differentiation in the Drosophila ommatidium. Dev. Biol. 120: 366–376.[CrossRef][Medline]
TREISMAN, J. E., A. LUK, G. M. RUBIN and U. HEBERLEIN, 1997 eyelid antagonizes wingless signaling during Drosophila development and has homology to the Bright family of DNA-binding proteins. Genes Dev. 11: 1949–1962.
VETTER, M. L., and N. L. BROWN, 2001 The role of basic helix-loop-helix genes in vertebrate retinogenesis. Semin. Cell Dev. Biol. 12: 491–498.[CrossRef][Medline]
VRAILAS, A. D., D. R. MARENDA, S. E. COOK, M. A. POWERS, J. A. LORENZEN et al., 2006 smoothened and thickveins regulate Moleskin/Importin 7-mediated MAP kinase signaling in the developing Drosophila eye. Development 133: 1485–1494.
VRAILAS, A. D., and K. MOSES, 2006 Smoothened, thickveins and the genetic control of cell cycle and cell fate in the developing Drosophila eye. Mech. Dev. 123: 151–165.[CrossRef][Medline]
WANG, S. W., B. S. KIM, K. DING, H. WANG, D. SUN et al., 2001 Requirement for math5 in the development of retinal ganglion cells. Genes Dev. 15: 24–29.
WHITE, N. M., and A. P. JARMAN, 2000 Drosophila atonal controls photoreceptor R8-specific properties and modulates both receptor tyrosine kinase and Hedgehog signalling. Development 127: 1681–1689.[Abstract]
WOLFF, T., and D. F. READY, 1993 Pattern formation in the Drosophila retina, pp. 1277–1325 in The Development of Drosophila melanogaster, edited by M. BATE and A. MARTINEZ-ARIAS. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY.
XU, T., and G. M. RUBIN, 1993 Analysis of genetic mosaics in developing and adult Drosophila tissues. Development 117: 1223–1237.[Abstract]
YAN, R. T., W. MA, L. LIANG and S. Z. WANG, 2005 bHLH genes and retinal cell fate specification. Mol. Neurobiol. 32: 157–171.[CrossRef][Medline]
YANG, Z., K. DING, L. PAN, M. DENG and L. GAN, 2003 Math5 determines the competence state of retinal ganglion cell progenitors. Dev. Biol. 264: 240–254.[CrossRef][Medline]
ZENG, C., S. YOUNGER-SHEPHERD, L. Y. JAN and Y. N. JAN, 1998 Delta and Serrate are redundant Notch ligands required for asymmetric cell divisions within the Drosophila sensory organ lineage. Genes Dev. 12: 1086–1091.
ZRALY, C. B., D. R. MARENDA, R. NANCHAL, G. CAVALLI, C. MUCHARDT et al., 2003 SNR1 is an essential subunit in a subset of Drosophila brm complexes, targeting specific functions during development. Dev. Biol. 253: 291–308.[CrossRef][Medline]
Communicating editor: T. SCHÜPBACH
- THIS ARTICLE
-
Abstract
- Full Text (PDF)
- Data Supplement
-
All Versions of this Article:
genetics.108.093302v1
180/4/2095 most recent - Alert me when this article is cited
- Alert me if a correction is posted
- SERVICES
- Email this article to a friend
- Similar articles in this journal
- Similar articles in PubMed
- Alert me to new issues of the journal
- Download to citation manager
- Reprints & Permissions
- CITING ARTICLES
- Citing Articles via Google Scholar
- GOOGLE SCHOLAR
- Articles by Melicharek, D.
- Articles by Marenda, D. R.
- Search for Related Content
- PUBMED
- PubMed Citation
- Articles by Melicharek, D.
- Articles by Marenda, D. R.







