Originally published as Genetics Published Articles Ahead of Print on June 8, 2005.

Genetics, Vol. 171, 393-401, September 2005, Copyright © 2005
doi:10.1534/genetics.105.044644

Mutational Analysis of the pH Signal Transduction Component PalC of Aspergillus nidulans Supports Distant Similarity to BRO1 Domain Family Members

* Department of Infectious Diseases, Faculty of Medicine, Imperial College London, London W12 0NN, United Kingdom and {dagger} Departamento de Microbiología Molecular, Centro de Investigaciones Biológicas CSIC, Madrid 28040, Spain

1 Corresponding author: Department of Infectious Diseases, Imperial College London, Hammersmith Hospital Campus, Ducane Rd., London W12 0NN, United Kingdom.
E-mail: j.tilburn{at}imperial.ac.uk

Manuscript received April 21, 2005. Accepted for publication May 6, 2005.

ABSTRACT

The alkaline ambient pH signal transduction pathway component PalC has no assigned molecular role. Therefore we attempted a gene-specific mutational analysis and obtained 55 new palC loss-of-function alleles including 24 single residue substitutions. Refined similarity searches reveal conserved PalC regions including one with convincing similarity to the BRO1 domain, denoted PCBROH, where clustering of mutational changes, including PCBROH key residue substitutions, supports its structural and/or functional importance. Since the BRO1 domain occurs in the multivesicular body (MVB) pathway protein Bro1/Vps31 and also the pH signal transduction protein PalA (Rim20), both of which interact with MVB component (ESCRT-III protein) Vps32/Snf7, this might reflect a further link between the pH response and endocytosis.


REGULATION by ambient pH has been extensively studied in Aspergillus nidulans where it is mediated by the PacC/Pal regulatory circuit and major contributions have also been made by studies on the equivalent Rim systems in the yeasts Saccharomyces cerevisiae, Candida albicans, and Yarrowia lipolytica.

Response to ambient pH in A. nidulans (reviewed by PEÑALVA and ARST 2002, 2004; ARST and PEÑALVA 2003) is mediated by PacC (CADDICK et al. 1986; TILBURN et al. 1995), which is activated by a two-step proteolysis of the full-length form, PacC72 (OREJAS et al. 1995; MINGOT et al. 1999; DÍEZ et al. 2002), in response to the alkaline ambient pH signal transduced by the six-membered Pal signaling pathway (ARST et al. 1994). The functional PacC 250-residue form, PacC27, is an activator of alkaline-expressed genes (ESPESO and PEÑALVA 1996) and repressor of acid-expressed genes (ESPESO and ARST 2000).

Signal transduction components PalH and PalI (S. cerevisiae homologs Rim21p and Rim9p, respectively) are predicted seven- and four-pass membrane proteins (LI and MITCHELL 1997; DENISON et al. 1998; NEGRETE-URTASUN et al. 1999) and strong candidates as ambient pH sensors. PalB (S. cerevisiae Rim13p), a calpain-like cysteine protease (DENISON et al. 1995; LAMB et al. 2001; SORIMACHI and SUZUKI 2001), is probably responsible for the first, pH-sensitive, signaling proteolysis. PalA (S. cerevisiae Rim20p) (NEGRETE-URTASUN et al. 1997; XU and MITCHELL 2001) contains the ~160-residue BRO1 domain (PFAM domain PF03097; http://www.sanger.ac.uk/Software/Pfam/index.shtml), first identified in yeast Bro1p (NICKAS and YAFFE 1996). PalA apparently enables the signaling proteolysis by interacting both with PacC, through two YPXL/I motifs flanking the signaling proteolysis site, and with Vsp32/Snf7, the endosomal sorting complex required for transport-III (ESCRT-III) protein, as demonstrated by VINCENT et al. (2003). This agrees with the model described for S. cerevisiae (XU and MITCHELL 2001; XU et al. 2004) where Rim20p (PalA) interacts with both Rim101p (PacC) (XU and MITCHELL 2001) and Vsp32p/Snf7p, which also interacts with Rim13p (PalB) (ITO et al. 2001), to form a scaffold-promoting interaction between the Rim101p cleavage site and the Rim13p protease. A functional link between pH signal transduction and multivesicular body (MVB) pathway sorting complexes has been firmly established in S. cerevisiae (XU et al. 2004) and shown to be conserved in C. albicans (KULLAS et al. 2004; XU et al. 2004).

Possible molecular roles remain elusive for PalF (S. cerevisiae Rim8p) and PalC, which has no S. cerevisiae homolog (LI and MITCHELL 1997; MACCHERONI et al. 1997; NEGRETE-URTASUN et al. 1999). As the PalC primary amino acid sequence revealed no evident sequence signature and PalC appeared absent from the hemiascomycete lineage, we carried out mutational analysis of this protein along with sequence profile similarity searching, exploiting the recent publication of a number of fungal genomes.

Mutational analysis:

The GABA ({gamma}-aminobutyrate) technique is a powerful tool for the selection of pacC (MINGOT et al. 1999; FERNÁNDEZ-MARTÍNEZ et al. 2003) and pal (ARST et al. 1994; DENISON et al. 1998; NEGRETE-URTASUN et al. 1999) loss-of-function mutations. It relies on the ability of these acidity-mimicking mutations to suppress areAr (= areA, nitrogen metabolite repressed) mutations for utilization of {gamma}-aminobutyrate (GABA) as the nitrogen source, through derepression of acid-expressed gabA specifying the GABA permease (CADDICK et al. 1986; HUTCHINGS et al. 1999; ESPESO and ARST 2000). In haploid strains, the GABA technique yields mutations in any of the seven pH regulatory genes. To target mutations to palC, we employed an areAr palC+/areAr palC diploid. This diploid cannot use GABA as the nitrogen source but suppression can be achieved by acidity mimicry, resulting from mutation of the palC+ allele or through mitotic recombination yielding palC homozygosity. To avoid the latter, we constructed diploid R using inoB2 (inositol auxotrophy) distal to palC40 (NEGRETE-URTASUN et al. 1999) and in repulsion to areAr18 (ARST et al. 1989), a reciprocal translocation of chromosomes III and IV, including palC and inoB (Figure 1). Consequently, palC40 homozygosity without inositol auxotrophy can occur only through alignment of the translocation-containing chromosome III and the untranslocated chromosome IV with recombination both between the areAr18 breakpoint and palC40 (4 cM) and between palC40 and inoB2 (22 cM) (Figure 1).



View larger version (14K):
In this window
In a new window
Download PPT slide
 
FIGURE 1.—

Diploid R (used for palC mutant selection). (A) Chromosomes III and IV of diploid R areAr18/areAr3 palC40 inoB2. The diploid was constructed using standard classical genetic techniques (CLUTTERBUCK 1993) between parents of the relevant partial genotypes areAr18 (nitrogen metabolite repressed) (ARST et al. 1989) and inoB2 (inositol requiring), areAr3 (nitrogen metabolite repressed), and palC40 (acidity mimicking) (NEGRETE-URTASUN 1997; NEGRETE-URTASUN et al. 1999). (B) Chromosomes III and IV after replication. (Ci) If alignment and recombination occur between duplicated homologous (with respect to the centromeres) non-sister chromatids of chromosome IV, homozygosity for palC40 would always result in homozygosity for inoB2 and thus in inositol auxotrophy, due to the areAr18 translocation that precludes recombination between palC40 and inoB2. Recovery of palC40 inoB2 homozygotes is prevented by excluding inositol from the selection medium. (Cii) If alignment occurs between the homologous regions of chromosomes III and IV (with respect to the centromeres) and if two recombination events occur, one between the areAr18 breakpoint and palC40 and a second between palC40 and inoB2, inoB+ palC40 homozygotes can result.

 
The first experiment Table 1 yielded 48 acidity-mimicking—as determined by impaired growth on pH 8 medium (COVE 1976)—palC mutants. These included 24 new truncations, 8 single and one double missense, two with three-base deletions, and one rearrangement mutation (data not shown) plus 12 palC40 mitotic recombinants, despite precautions. In a second attempt and to avoid null phenotype palC truncations, we screened for leaky or temperature-sensitive growth on pH 8.0 medium and obtained another 20 palC missense mutants, thus totaling 55 new palC alleles (Table 1). Alignment (Figure 2) illustrates that most of the missense mutations affect amino acids conserved in the majority of the ascomycete PalCs shown. Of the single residue change mutations, only palC80 (Gly321Asp) and palC162 ({Delta}Arg442) are complete loss-of-function mutations. All truncating mutations result in complete loss of function except the leaky palC131 (1–454 + 2), which removes 53 C-terminal residues including a completely conserved C-terminal di-aromatic motif. This motif (di-tyrosine in A. nidulans PalC) resembles the di-phenylalanine motif, a C-terminal transport motif facilitating ER export (NUFER et al. 2002). As palC131 is partially functional, this motif and other residues C-terminal to residue 454 cannot be completely essential for PalC structure and function. The complete loss-of-function truncating mutations palC159 (1–427 + 29) and palC153 and palC179, truncating the protein cleanly after residue 426, indicate that at least some of residues 427–454 are essential, which agrees with the clustering of mutations in this window. Mutations substituting conserved residues in regions "BRO1 similar," "LALA," and "ERRE" (Figure 4B) further support the structural and/or functional importance of these regions. We caution, however, that the phenotypes of any of the palC mutations characterized here might be due to reduced PalC protein levels resulting from protein misfolding with consequent instability or even from messenger instability rather than from PalC dysfunction.


View this table:
In this window
In a new window

 
TABLE 1

palC mutations isolated in this work

 


View larger version (92K):
In this window
In a new window
Download PPT slide
 
FIGURE 2.—

Alignment of some ascomycete and basidiomycete PalCs and a zygomycete PalC. The alignment was carried out using the T-Coffee multiple sequence alignment (NOTREDAME et al. 2000). Shading was according to the Blosum62 matrix: >90% similarity, solid background; 50–90% similarity, dark shading; 30–50% similarity, light shading. Residue-substituting mutations are indicated by {uparrow}; different substitutions of the same residue are indicated by /; double mutations in the same allele are indicated by parentheses; {Downarrow} marks the ultimate wild-type residue in PalC159, the most C-terminal total loss-of-function truncated mutant protein; {downarrow} indicates the ultimate wild-type residue in the leaky truncated mutant PalC131 protein. Residues 38–235 composing the PCBROH domain (see Figure 4 and text) are italicized. A total of 73 Ustilago maydis PalC residues with no similarity to any other protein shown have been removed from the fifth block of the alignment. They are: 315-HAGTQIGLSANHEHELASRLSASRDRADHEHDDDMVETNRGAGAQATSKRNKLLGRFKLGSSKSSPPRSASVH-388. Initials refer to species names used in A. With the sole exception of the A. nidulans PalC, for which complete cDNA sequence is available, proteins from all other fungi were conceptually translated from predicted genes derived from genomic sequences. In Neurospora crassa, Fusarium graminearum, Magnaporthe grisea, and U. maydis, for which automatic gene annotations were available, our deduced intron/exon organizations were coincident with automatic predictions (gene models NCU03316.1, FG05608.1, MG09311.4, and UM04392.1, respectively). See supplementary Table S1 at http://www.genetics.org/supplemental/ for sequence sources.

 


View larger version (85K):
In this window
In a new window
Download PPT slide
 
FIGURE 4.—

Conserved regions in PalC. (A) The PalC BRO1 homology. Multiple sequence alignment of five ascomycete PalC proteins and representative members of each of five PF03097/BRO1-containing protein subfamilies illustrates sequence similarity between PalCs (indicated with a black bar on the left) and Bro1-like proteins. The five PF03097 subfamilies have been recognized by phylogenic analysis (J. C. SÁNCHEZ-FERRERO, O. VINCENT and M. A. PEÑALVA, unpublished results) and comprise PalA ascomycete proteins (indicated with a red bar), BRO1 ascomycete proteins (yellow bar), metazoan AIP1(s)/Alix(es) (blue bar), rhophilins (RHPs, gray bar), and protein tyrosine phosphatases of the TD14 p164 class (HDPTPs, green bar). Fully (or nearly so) conserved residues are in magenta, with the consensus shown below the corresponding column. Blom62 similarity groups, where "6" indicates leucine, isoleucine, valine, and methionine, were used. Blue and yellow indicate decreasing degrees of conservation. Only columns having at least one residue conserved in both PalCs and Bro1s were shaded. Arrowheads denote PCBROH conserved residues substituted in extant loss-of-function mutants. An, A. nidulans; Ci, C. immitis; Fg, F. graminaerum; Nc, N. crassa; Cn, C. neoformans; Sc, S. cerevisiae; Hs, Homo sapiens; Ce, Caenorhabditis elegans; Fr, Fugu rubripes. See supplementary Tables S1 and S2 at http://www.genetics.org/supplemental/ for sources of PalC orthologous sequences and BRO1 domain-containing protein sequences, respectively. The PalC Hidden Markov model corresponding to A. nidulans residues 38–235 was constructed using HMMer 2.3.2 and 15 of the 17 available PalC ortholog sequences in the databases, including those in supplementary Table S1 at http://www.genetics.org/supplemental/ except the PalCs of Aspergillus fumigatus and Aspergillus oryzae, which were not included to avoid overrepresentation of sequences too closely related to the A. nidulans PalC. (B) Schematic of the PalC primary structure, where N-ter, LALA, RARA, and ERRE refer to blocks of strong identity/similarity as deduced from ascomycete alignment (see Figure 2); the C-terminal red oval is the fully conserved PalC di-aromatic motif (see Figure 2). Single residue mutant substitutions described in this work are indicated by red triangles (blue if more than one residue substitution is at that position). The PCBROH region is as defined in A. The black arrow indicates the limit of extant complete loss-of-function truncations, whereas the blue arrow indicates the position of a partial loss-of-function truncation.

 

PalC orthologs:

PalC orthologs are present in members of three major fungal phyla, ascomycota, basidiomycota, and zygomycota (Figures 2 and 3). Among ascomycete PalCs the Y. lipolytica ortholog Figure 2 is the first to be detectable in hemiascomycetes (yeasts). This dispels the notion, based on the failure to detect PalC homologs in the previously available hemiascomycete genomes (supplementary Table S1 at http://www.genetics.org/supplemental/) of Ashbya gosypii, C. albicans, Candida glabrata, Debaryomyces hansenii, Kluyveromyces lactis, S. cerevisiae, and Schizosaccharomyces pombe, that PalCs are exclusive to euascomycetes (filamentous fungi). As strong comparative genomic evidence indicates that Y. lipolytica separated early from the main hemiascomycete line and has not been subjected to the significant constraints in genome size characterizing other yeasts (DUJON et al. 2004), we suggest that palC was present in a universal fungal ancestor and that palC orthologs might have been lost from most hemiascomycetes.



View larger version (16K):
In this window
In a new window
Download PPT slide
 
FIGURE 3.—

Phylogenetic tree relating PalC orthologs used in this work. This was constructed using MEGA version 3.0 neighbor-joining method (KUMAR et al. 2004). D is a measure of sequence divergence.

 
Y. lipolytica palC is the only homolog of an A. nidulans pH regulatory gene not identified by mutations affecting pH regulation of extracellular proteases (TRÉTON et al. 2000; GONZALEZ-LOPEZ et al. 2002). Thus its functional involvement in pH regulation remains to be established.

Refined similarity searching reveals the PalC-related protein family:

As sequence similarity searches gave no indication of a possible molecular role for PalC, we also used the relatively sensitive procedures of HMMer (EDDY 1998) and PSI-BLAST (ALTSCHUL et al. 1997) to seek PalC-related protein families. Searching the nrdbembl (January 2005) protein database with the 262 N-terminal residues of PalC detected, as well as PalC orthologs, we detected two members of the PFAM BRO1 domain family after the third round of iteration with E-values markedly below the cutoff (E = 0.005) and all 63 PFAM PF03097 BRO1-like domain-containing proteins after the eighth iteration and retrieved no new unrelated sequences subsequently. This relationship to BRO1 domain proteins was highly suggestive in view of the PalA BRO1 domain and was substantiated using a Hidden Markov model derived from the region of similarity corresponding to A. nidulans PalC 38–235 in the 14 PalCs available to query the nrdbembl, which detected three BRO1 domain proteins with reasonable scores (0.0018–0.046). In a third approach, a PalC Hidden Markov model in an HHpred (SÖDING 2005) search of the PFAM database gave only one significant hit (E-value 3e-05), the BRO1-like domain. These data provide statistical evidence that a region of PalC comprising residues 28–235 is significantly, albeit remotely, related to the PFAM PF03097 BRO1-like domain and a region of similarity extending downstream from it (Figure 4A). We have denoted this region PCBROH (PalC-BRO1 homology). The frequency of mutational changes here and their occurrence in key PCBROH residues such as Tyr68 and Trp111 indicate a major functional and/or structural role in PalC (Figure 4B).

BRO1 domain proteins include, as well as PalA (NEGRETE-URTASUN et al. 1997), PalA orthologs Rim20p (S. cerevisiae and C. albicans) (XU and MITCHELL 2001), the human PalA homolog AIP1/Alix (MISSOTTEN et al. 1999; VITO et al. 1999), and the yeast Bro1p (NICKAS and YAFFE 1996), an MVB pathway protein recruiting the deubiquitinase Doa4p to endosomes (ODORRIZI et al. 2003; LUHTALA and ODORRIZI 2004). All these proteins interact with Vps32p/Snf7p (a key component of ESCRT-III) or its homologs (XU and MITCHELL 2001; KATOH et al. 2003; STRACK et al. 2003; VINCENT et al. 2003; VON SCHWEDLER et al. 2003; KATOH et al. 2004; PECK et al. 2004; XU et al. 2004).

It has been suggested that the BRO1 domain is the region of interaction between Rim20p-Bro1p family members and Snf7p family members (XU et al. 2004). However, the finding that the BRO1 domain-containing protein human rhophilin-2 did not interact with either of two human hSnf7 proteins tested (PECK et al. 2004) argues against this generalization. Thus a precise role for the BRO1-like domain in PalC cannot be assigned. However, it is tempting to speculate that it reflects a further link between the pH response system and the MVB pathway multiprotein complexes at the endosome and/or cell membrane.

The PacC-mediated pH regulatory system is an important virulence determinant in plant (reviewed by PEÑALVA and ARST 2004) and animal pathogens, including C. albicans (reviewed by FONZI 2002; PEÑALVA and ARST 2002; DAVIS 2003) and A. nidulans (BIGNELL et al. 2005). In view of the growing frequency of invasive mold, and in particular of Aspergillus infections (reviewed by CLARK and HAJJEH 2002), the uniquely fungal PalC might possibly be a suitable target for therapeutic intervention.


ACKNOWLEDGEMENTS
We are grateful to Lily Stanton for technical assistance; Elaine Bignell, Eduardo Espeso, and Olivier Vincent for comments on the manuscript; and Joanna Rudnicka for interesting discussion. We thank the Wellcome Trust, the Dirección General de Investigación Científica y Técnica, and the Consejo Superior de Investigaciones Científicas (CSIC) for their support through grants 067878, BIO2003-0077, and for a CSIC Bioinformatics I3P studentship for J.C.S.-F., respectively.

Note added in proof: The structure of the Bro1 domain in yeast Bro1p has been determined (J. KIM, S. SITARAMAN, A. HIERRO, B. M. BEACH, G. ODORRIZI and J. H. HURLEY, 2005, Structural basis for endosomal targeting by the Bro1 domain. Dev. Cell 8: 937–947) and establishes that the Bro1 domain contains 367 residues, thereby extending considerably beyond the 160-residue Bro1p PFAM domain. Sequence alignment suggests that the region of A. nidulans PalC corresponding to the structurally based Bro1 domain of Bro1p includes the PalC N-terminal 446 residues, within which the majority of our single residue substitutions fall. Conserved PalC residues Arg47, Tyr68, Trp111, and Glu136 (Figures 2 and 4A) are likely to correspond, respectively, to Bro1p residues Arg51, Tyr70, Trp94, and Glu116, which are central in one of two structure-stabilizing, buried, charged, and polar clusters. The loss-of-function phenotypes of palC Tyr68His or -Asn and Trp111Arg mutations are consistent with the predicted structural importance of these residues.


LITERATURE CITED

ALTSCHUL, S. F., T. L. MADDEN, A. A. SCHÄFFER, J. ZHANG, Z. ZHANG et al., 1997 Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res. 25: 3389–3402.[Abstract/Free Full Text]

ARST, H. N., JR., and M. A. PEÑALVA, 2003 pH regulation in Aspergillus and parallels with higher eukaryotic regulatory systems. Trends Genet. 19: 224–231.[CrossRef][Medline]

ARST, H. N., JR., D. TOLLERVEY and M. X. CADDICK, 1989 A translocation associated, loss-of-function mutation in the nitrogen metabolite repression regulatory gene of Aspergillus nidulans can revert intracistronically. Mol. Gen. Genet. 215: 364–367.[CrossRef][Medline]

ARST, H. N., JR., E. BIGNELL and J. TILBURN, 1994 Two new genes involved in signalling ambient pH in Aspergillus nidulans. Mol. Gen. Genet. 245: 787–790.[CrossRef][Medline]

BIGNELL, E., S. NEGRETE-URTASUN, A. M. CALCAGNO, K. HAYNES, H. N. ARST, JR. et al., 2005 The Aspergillus pH-responsive transcription factor PacC regulates virulence. Mol. Microbiol. 55: 1072–1084.[CrossRef][Medline]

CADDICK, M. X., A. G. BROWNLEE and H. N. ARST, JR., 1986 Regulation of gene expression by pH of the growth medium in Aspergillus nidulans. Mol. Gen. Genet. 203: 346–353.[CrossRef][Medline]

CLARK, T. A., and R. A. HAJJEH, 2002 Recent trends in the epidemiology of invasive mycoses. Curr. Opin. Infect. Dis. 15: 569–574.[Medline]

CLUTTERBUCK, A. J., 1993 Aspergillus nidulans, pp. 3.71–3.84 in Genetic Maps of Complex Genomes, edited by S. J. O'BRIEN. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY.

COVE, D. J., 1966 The induction and repression of nitrate reductase in the fungus Aspergillus nidulans. Biochim. Biophys. Acta 113: 51–56.[Medline]

COVE, D. J., 1976 Chlorate toxicity in Aspergillus nidulans. Studies of mutants altered in nitrate assimilation. Mol. Gen. Genet. 146: 147–159.[CrossRef][Medline]

DAVIS, D., 2003 Adaptation to environmental pH in Candida albicans and its relation to pathogenesis. Curr. Genet. 44: 1–7.[CrossRef][Medline]

DENISON, S. H., M. OREJAS and H. N. ARST, JR., 1995 Signaling of ambient pH in Aspergillus involves a cysteine protease. J. Biol. Chem. 270: 28519–28522.[Abstract/Free Full Text]

DENISON, S. H., S. NEGRETE-URTASUN, J. M. MINGOT, J. TILBURN, W. A. MAYER et al., 1998 Putative membrane components of signal transduction pathways for ambient pH regulation in Aspergillus and meiosis in Saccharomyces are homologous. Mol. Microbiol. 30: 259–264.[CrossRef][Medline]

DÍEZ, E., J. ÁLVARO, E. A. ESPESO, L. RAINBOW, T. SUÁREZ et al., 2002 Activation of the Aspergillus zinc-finger transcription factor requires two proteolytic steps. EMBO J. 21: 1350–1359.[CrossRef][Medline]

DUJON, B., D. SHERMAN, G. FISCHER, P. DURRANS, S. CASAREGALO et al., 2004 Genome evolution in yeasts. Nature 430: 35–44.[CrossRef][Medline]

EDDY, S. R., 1998 Profile hidden Markov models. Bioinformatics 14: 755–763.[Abstract/Free Full Text]

ESPESO, E. A., and H. N. ARST, JR., 2000 On the mechanism by which alkaline pH prevents expression of an acid-expressed gene. Mol. Cell. Biol. 20: 3355–3363.[Abstract/Free Full Text]

ESPESO, E. A., and M. A. PeÑALVA, 1996 Three binding sites for the Aspergillus PacC zinc-finger transcription factor are necessary and sufficient for regulation by ambient pH of the isopenicillin N synthase gene promoter. J. Biol. Chem. 271: 28825–28830.[Abstract/Free Full Text]

FERNÁNDEZ-MARTÍNEZ, J., C. V. BROWN, E. DÍEZ, J. TILBURN, H. N. ARST, JR. et al., 2003 Overlap of nuclear localisation signal and specific DNA-binding residues within the zinc finger domain of PacC. J. Mol. Biol. 334: 667–684.[CrossRef][Medline]

FONZI, W. A., 2002 Role of pH response in Candida albicans virulence. Mycoses 45 (Suppl. 1): 16–21.

GONZALEZ-LOPEZ, C. I., R. SZABO, S. BLANCHIN-ROLAND and C. GAILLARDIN, 2002 Genetic control of extracellular protease synthesis in the yeast Yarrowia lypolitica. Genetics 160: 417–427.[Abstract/Free Full Text]

HASTIE, A. C., 1970 Benlate-induced instability of Aspergillus diploids. Nature 226: 771.[Medline]

HUTCHINGS, H., K.-P. STAHMANN, S. ROELS, E. A. ESPESO, W. E. TIMBERLAKE et al., 1999 The multiply-regulated gabA gene encoding the GABA permease of Aspergillus nidulans: a score of exons. Mol. Microbiol. 32: 557–568.[CrossRef][Medline]

ITO, T., T. CHIBA, R. OZAWA, M. YOSHIDA, M. HATTORI et al., 2001 A comprehensive two-hybrid analysis to explore the yeast proteome interactome. Proc. Natl. Acad. Sci. USA 98: 4569–4574.[Abstract/Free Full Text]

KATOH, K., H. SHIBATA, H. SUZUKI, A. NARA, K. ISHIDOH et al., 2003 The ALG-2-interacting protein Alix associates with CHMP4b, a human homologue of yeast Snf7 that is involved in multivesicular body sorting. J. Biol. Chem. 278: 39104–39113.[Abstract/Free Full Text]

KATOH, K., H. SHIBATA, K. HATTA and M. MAKI, 2004 CHMP4b is a major binding partner of the ALG-2-interacting protein Alix among the three CHMP4 isoforms. Arch. Biochem. Biophys. 421: 159–165.[CrossRef][Medline]

KULLAS, A. L., M. LI and D. A. DAVIS, 2004 Snf7p, a component of the ESCRT-III protein complex, is an upstream member of the RIM101 pathway in Candida albicans. Eukaryot. Cell 3: 1609–1618.[Abstract/Free Full Text]

KUMAR, S., K. TAMURA and M. NEI, 2004 MEGA3: integrated software for Molecular Evolutionary Genetics Analysis and sequence alignment. Brief. Bioinform. 5: 150–163.[Abstract/Free Full Text]

LAMB, T. M., W. XU, A. DIAMOND and A. P. MITCHELL, 2001 Alkaline response genes of Saccharomyces cerevisiae and their relationship to the RIM101 pathway. J. Biol. Chem. 276: 1850–1856.[Abstract/Free Full Text]

LI, W., and A. P. MITCHELL, 1997 Proteolytic activation of Rim1p, a positive regulator of yeast sporulation and invasive growth. Genetics 145: 63–73.[Abstract]

LUHTALA, N., and G. ODORRIZI, 2004 Bro1 coordinates deubiquitination in multivesicular body pathway by recruiting Doa4 to endosomes. J. Cell Biol. 166: 717–729.[Abstract/Free Full Text]

MACCHERONI, W., JR., G. S. MAY, N. M. MARTINEZ-ROSSI and A. ROSSI, 1997 The sequence of palF, an environmental pH response gene in Aspergillus nidulans. Gene 194: 163–167.[CrossRef][Medline]

MINGOT, J. M., J. TILBURN, E. DÍEZ, E. BIGNELL, M. OREJAS et al., 1999 Specificity determinants of proteolytic processing of Aspergillus PacC transcription factor are remote from the processing site, and processing occurs in yeast if pH signalling is bypassed. Mol. Cell. Biol. 19: 1390–1400.[Abstract/Free Full Text]

MISSOTTEN, M., A. NICHOLS, K. RIEGER and R. SADOUL, 1999 Alix, a novel mouse protein undergoing calcium-dependent interaction with the apoptosis-linked-gene 2 (ALG-2) protein. Cell Death Differ. 6: 124–129.[CrossRef][Medline]

NEGRETE-URTASUN, S., 1997 Aspects of the pH signal transduction pathway in the filamentous fungus Aspergillus nidulans. Ph.D. Thesis, University of London, London.

NEGRETE-URTASUN, S., S. H. DENISON and H. N. ARST, JR., 1997 Characterization of the pH signal transduction pathway gene palA of Aspergillus nidulans and identification of possible homologs. J. Bacteriol. 179: 1832–1835.[Abstract/Free Full Text]

NEGRETE-URTASUN, S., W. REITER, E. DÍEZ, S. H. DENISON, J. TILBURN et al., 1999 Ambient pH signal transduction in Aspergillus: completion of gene characterization. Mol. Microbiol. 33: 994–1003.[CrossRef][Medline]

NICKAS, M. E., and M. P. YAFFE, 1996 BRO1, a novel gene that interacts with components of the Pkc1p-mitogen-activated protein kinase pathway in Saccharomyces cerevisiae. Mol. Cell. Biol. 16: 2585–2593.[Abstract]

NOTREDAME, C., D. G. HIGGINS and J. HERINGA, 2000 T-Coffee: a novel method for fast and accurate multiple sequence alignment. J. Mol. Biol. 302: 205–217.[CrossRef][Medline]

NUFER, O., S. GULDBRANSEN, M. DEGEN, F. KAPPELER, J. P. PACCAUD et al., 2002 Role of cytoplasmic C-terminal amino acids of membrane proteins in ER export. J. Cell Sci. 115: 619–628.[Abstract/Free Full Text]

ODORRIZI, G., D. J. KATZMANN, M. BABST, A. AUDHYA and S. D. EMR, 2003 Bro1 is an endosome-assiociated protein that functions in the MVB pathway in Saccharomyces cerevisiae. J. Cell Sci. 116: 1893–1903.[Abstract/Free Full Text]

OREJAS, M., E. A. ESPESO, J. TILBURN, S. SARKAR, H. N. ARST, JR., et al., 1995 Activation of the Aspergillus PacC transcription factor in response to alkaline ambient pH requires proteolysis of the carboxy-terminal moiety. Genes Dev. 9: 1622–1632.[Abstract/Free Full Text]

PECK, J. W., E. T. BOWDEN and P. D. BURBELO, 2004 Structure and function of human Vps20 and Snf7 proteins. Biochem. J. 377: 693–700.[Medline]

PEÑALVA, M. A., and H. N. ARST, JR., 2002 Regulation of gene expression by ambient pH in filamentous fungi and yeasts. Microbiol. Mol. Biol. Rev. 66: 426–446.[Abstract/Free Full Text]

PEÑALVA, M. A., and H. N. ARST, JR., 2004 Recent advances in the characterization of ambient pH regulation of gene expression in filamentous fungi and yeasts. Annu. Rev. Microbiol. 58: 425–451.[CrossRef][Medline]

SÖDING, J., 2005 Protein homology detection by HMM-HMM comparison. Bioinformatics 21: 951–960.[Abstract/Free Full Text]

SORIMACHI, H., and K. SUZUKI, 2001 The structure of calpain. J. Biochem. 129: 653–664.[Abstract/Free Full Text]

STRACK, B., A. CALISTRI, S. CRAIG, E. POPOVA and H. G. GÖTTLINGER, 2003 AIP1/ALIX is a binding partner for HIV-1 p6 and EIAV p9 functioning in virus budding. Cell 114: 689–699.[CrossRef][Medline]

TILBURN, J., S. SARKAR, D. A. WIDDICK, E. A. ESPESO, M. OREJAS et al., 1995 The Aspergillus PacC transcription factor mediates regulation of both acid- and alkaline expressed genes by ambient pH. EMBO J. 14: 779–790.[Medline]

TRÉTON, B., S. BLANCHIN-ROLAND, M. LAMBERT, A. LÉPINGLE and C. GAILLARDIN, 2000 Ambient pH signalling in ascomycetous yeasts involves homologues of the Aspergillus nidulans genes palF and palH. Mol. Gen. Genet. 263: 505–513.[CrossRef][Medline]

VINCENT, O., L. RAINBOW, J. TILBURN, H. N. ARST, JR. and M. A. PEÑALVA, 2003 YPXL/I is a protein interaction motif recognized by Aspergillus PalA and its human homologue AIP1/Alix. Mol. Cell. Biol. 23: 1647–1655.[Abstract/Free Full Text]

VITO, P., L. PELLEGRINI, C. GUIET and L. D'ADAMIO, 1999 Cloning of AIP1, a novel protein that associates with the apoptosis-linked gene ALG-2 in a Ca2+-dependent reaction. J. Biol. Chem. 274: 1533–1540.[Abstract/Free Full Text]

VON SCHWEDLER, U. K., M. STUCHELL, B. MÜLLER, D. M. WARD, H. Y. CHUNG et al., 2003 The protein network of HIV budding. Cell 114: 701–713.[CrossRef][Medline]

XU, W., and A. P. MITCHELL, 2001 Yeast PalA/AIP1/Alix homolog Rim20p associates with a PEST-like region and is required for its proteolytic cleavage. J. Bacteriol. 183: 6917–6923.[Abstract/Free Full Text]

XU, W., F. J. SMITH, JR., R. SUBARAN and A. P. MITCHELL, 2004 Multivesicular body-ESCRT components function in pH response regulation in Saccharomyces cerevisiae and Candida albicans. Mol. Biol. Cell 15: 5528–5537.[Abstract/Free Full Text]

Communicating editor: A. MITCHELL




This article has been cited by other articles:


Home page
MicrobiologyHome page
S. Blanchin-Roland, G. Da Costa, and C. Gaillardin
Ambient pH signalling in the yeast Yarrowia lipolytica involves YlRim23p/PalC, which interacts with Snf7p/Vps32p, but does not require the long C terminus of YlRim9p/PalI
Microbiology, June 1, 2008; 154(6): 1668 - 1676.
[Abstract] [Full Text] [PDF]


Home page
Eukaryot CellHome page
A. M. Calcagno-Pizarelli, S. Negrete-Urtasun, S. H. Denison, J. D. Rudnicka, H.-J. Bussink, T. Munera-Huertas, L. Stanton, A. Hervas-Aguilar, E. A. Espeso, J. Tilburn, et al.
Establishment of the Ambient pH Signaling Complex in Aspergillus nidulans: PalI Assists Plasma Membrane Localization of PalH
Eukaryot. Cell, December 1, 2007; 6(12): 2365 - 2375.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
A. Hervas-Aguilar, J. M. Rodriguez, J. Tilburn, H. N. Arst Jr., and M. A. Penalva
Evidence for the Direct Involvement of the Proteasome in the Proteolytic Processing of the Aspergillus nidulans Zinc Finger Transcription Factor PacC
J. Biol. Chem., November 30, 2007; 282(48): 34735 - 34747.
[Abstract] [Full Text] [PDF]


Home page
Eukaryot CellHome page
C. Kragl, M. Schrettl, B. Abt, B. Sarg, H. H. Lindner, and H. Haas
EstB-Mediated Hydrolysis of the Siderophore Triacetylfusarinine C Optimizes Iron Uptake of Aspergillus fumigatus
Eukaryot. Cell, August 1, 2007; 6(8): 1278 - 1285.
[Abstract] [Full Text] [PDF]


Home page
Eukaryot CellHome page
M. M. Penas, A. Hervas-Aguilar, T. Munera-Huertas, E. Reoyo, M. A. Penalva, H. N. Arst Jr., and J. Tilburn
Further Characterization of the Signaling Proteolysis Step in the Aspergillus nidulans pH Signal Transduction Pathway
Eukaryot. Cell, June 1, 2007; 6(6): 960 - 970.
[Abstract] [Full Text] [PDF]