- THIS ARTICLE
-
Abstract
- Full Text (PDF)
- Alert me when this article is cited
- Alert me if a correction is posted
- SERVICES
- Email this article to a friend
- Similar articles in this journal
- Similar articles in PubMed
- Alert me to new issues of the journal
- Download to citation manager
- Reprints & Permissions
- CITING ARTICLES
- Citing Articles via HighWire
- Citing Articles via Google Scholar
- GOOGLE SCHOLAR
- Articles by Boase, N. A.
- Articles by Kelly, J. M.
- Search for Related Content
- PUBMED
- PubMed Citation
- Articles by Boase, N. A.
- Articles by Kelly, J. M.
Molecular Characterization and Analysis of the acrB Gene of Aspergillus nidulans: A Gene Identified by Genetic Interaction As a Component of the Regulatory Network That Includes the CreB Deubiquitination Enzyme
Natasha A. Boasea, Robin A. Lockingtona, Julian R. J. Adamsa, Louise Rodbourna, and Joan M. Kellyaa School of Molecular and Biomedical Science, University of Adelaide, Adelaide, 5005, SA, Australia
Corresponding author: Joan M. Kelly, Molecular Life Sciences Building, University of Adelaide, North Terrace, Adelaide, 5005, SA, Australia., joan.kelly{at}adelaide.edu.au (E-mail)
Communicating editor: M. S. SACHS
| ABSTRACT |
|---|
Mutations in the acrB gene, which were originally selected through their resistance to acriflavine, also result in reduced growth on a range of sole carbon sources, including fructose, cellobiose, raffinose, and starch, and reduced utilization of
-amino acids, including GABA and ß-alanine, as sole carbon and nitrogen sources. The acrB2 mutation suppresses the phenotypic effects of mutations in the creB gene that encodes a regulatory deubiquitinating enzyme, and in the creC gene that encodes a WD40-repeat-containing protein. Thus AcrB interacts with a regulatory network controlling carbon source utilization that involves ubiquitination and deubiquitination. The acrB gene was cloned and physically analyzed, and it encodes a novel protein that contains three putative transmembrane domains and a coiled-coil region. AcrB may play a role in the ubiquitination aspect of this regulatory network.
THE acrB2 mutation was isolated in the filamentous fungus Aspergillus nidulans as a spontaneous resistant sector on complete medium containing acriflavine in a genetic screen with the joint aims of understanding acriflavine toxicity and obtaining extra tools for genetic mapping (![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
Protein stability is a key regulatory mechanism in the control of metabolism, the cell cycle, cell growth and development, and disease. Selective degradation or stabilization of intracellular proteins by ubiquitin-dependent pathways is essential for correct regulation of many cellular processes. Ubiquitin is covalently attached to substrate proteins by a protein complex usually including an activating enzyme, a conjugating enzyme, and a protein ligase. A number of conjugating enzymes and protein ligases are in the cell, and various combinations confer substrate specificity on the system. The addition of four or more ubiquitins targets the substrates for destruction via the 26S proteasome, and free ubiquitin is recycled. The addition of fewer ubiquitins can alter function or target the protein to the endosomes. This process can be opposed by the action of deubiquitinating enzymes, which remove ubiquitin from specific substrates, thus stabilizing them. Perhaps the best-studied example of a regulatory deubiquitinating enzyme in a multicellular eukaryote is the Drosophila melanogaster Fat facets deubiquitinating enzyme, which is required for correct eye development (![]()
![]()
![]()
![]()
![]()
![]()
Since the role in the cell of the CreB/CreC complex is to remove ubiquitin from specific substrates, then suppressors of the phenotypic effects of mutations in creB or creC may define components of the specific regulatory ubiquitination system for these substrates. The phenotypic similarities between acrB2 and creD34 led us to analyze whether the acrB2 mutation is also a suppressor of the phenotypes due to creB and creC mutations, which would indicate a role for AcrB in a regulatory ubiquitination pathway that is required for correct regulation of carbon metabolism. Here we demonstrate that mutations in acrB result in altered utilization of various carbon sources in A. nidulans. In addition, we show that the effects of the acrB2 mutation are epistatic to those due to the creB and creC mutations, and thus the acrB gene product is likely to play a role in the regulatory ubiquitination/deubiquitination network that includes the CreB/CreC complex. Thus, to further understand the role of AcrB, we have cloned and physically analyzed the acrB gene.
| MATERIALS AND METHODS |
|---|
A. nidulans strains, media, growth conditions, and manipulations:
The Aspergillus media and growth conditions were as described by ![]()
![]()
![]()
![]()
![]()
|
Molecular methods:
Standard molecular techniques were as outlined in ![]()
![]()
![]()
Plasmid c24F6-14 was generated by a partial EcoRI digestion of cosmid SW23H06 followed by ligation to recircularize the products of digestion. ClaI subclones from c24F6-14 [p4AcrB (6-kb insert), p7AcrB (10-kb insert), and p10AcrB (2-kb insert)] were generated in the pBCSK+-based plasmid pCB1004 (![]()
is a SacI-generated deletion of p4AcrB. p4AcrBKpnI
is a KpnI-generated deletion of p4AcrB.
A. nidulans was transformed according to the method of ![]()
![]()
The acrB gene was sequenced using a combination of custom-designed oligonucleotide primers. Double-stranded DNA template was prepared using the Promega Wizard + SV miniprep system following the manufacturer's instructions. Sequencing reactions were as outlined in the Applied Biosystems (Foster City, CA) dye terminator system instructions and were analyzed at the Institute of Medical and Veterinary Science sequencing facility (Adelaide, Australia). Sequence analysis was performed using the Australian National Genomic Information Service facility or BioNavigator.
Intron positions were determined by the PCR amplification of acrB cDNA segments from DNA prepared from an A. nidulans cDNA library (kindly provided by S. Osmani) using custom oligonucleotides as primers and standard PCR conditions and cycle parameters. These products were purified and directly sequenced using the same primers used for amplification. The primer pairs used were acrB1 (5'-AGTCTTGGCTGCTATCCG-3'; -58 to -40) and KBF (5'-GACACGCCACCATTCGTC-3'; +329 to +312), KBB (5'-GCGAAGGGAAATGCAGAC-3'; +280 to +297) and KB (5'-ATGGGCTAAATCGAGAGC-3'; +726 to +709), AK (5'-GCAATGGATGGTTTCTGC-3'; +646 to +663) and SF (5'-CTCGCCTCGCCAATAGAT-3'; +1617 to +1600), KF (5'-CGCGTGGATACAGAAGCG-3'; +1066 to +1083) and AS (5'-CAATCTCTGCCTTGGCGG-3'; +2194 to +2177), SB (5'-AAGAGGCTACCGCCGCTC-3'; +2057 to +2074) and SBB (5'-GCGAGCGGTGGCTTGGCA-3'; +2641 to +2624), and SBF (5'-CTTGGGCACATTGGCGTC-3'; +2601 to +2618) and acrB5 (5'-AACCAGTCACTACACGGA-3'; +3249 to +3232).
The transcription start point was determined by direct sequencing of the nested PCR product and five subcloned products of 5' rapid amplification of cDNA ends (5' RACE) performed on total RNA from D-glucose-grown mycelium. 5' RACE was performed using the Ambion (Austin, TX) First Choice RLM-RACE kit, following the manufacturer's instructions.
Sequences of mutant alleles were determined by direct sequencing of PCR products derived from genomic DNA of the relevant mutant strain. These were sequenced using the same procedures as for intron determination. Direct sequencing of acrB PCR products from wild-type DNA was undertaken for comparison.
| RESULTS |
|---|
Phenotypic analysis of acrB2, acrB14, and acrB15:
As selected, the three acrB mutant strains, acrB2, acrB14, and acrB15, were resistant to the presence of acriflavine in complete medium, with similar levels of resistance between acrB mutant strains and the creD34 strain (Fig 1). Since the creD34 mutation leads to sensitivity to molybdate, the three acrB mutant strains were tested and found to be more sensitive than the wild-type strain to the presence of 11 mM molybdate in synthetic complete medium, but the alleles were heterogeneous, with the acrB2 strain being the most sensitive to the presence of molybdate and the acrB15 strain showing lesser sensitivity. Thus the effects of the acrB mutant alleles when the toxic compounds acriflavine and molybdate are added to the medium are the same as those for creD34 and the opposite to the effects of creB and creC mutant alleles, which confer increased sensitivity to acriflavine and resistance to molybdate added to complete medium (![]()
![]()
![]()
|
When tested for their ability to utilize various carbon sources, acrB mutant strains were found to have pleiotropic phenotypes with respect to carbon source utilization. They show decreased ability to utilize a number of different sugars as sole carbon sources in comparison to both the wild type and the creD34 mutant strain, including fructose, cellobiose, raffinose, and starch (Fig 1; Table 2). In general, the acrB14 strain showed a slightly more extreme phenotype than that showed by the acrB2 and acrB15 strains. The reduced growth on various sugars may indicate a failure of uptake or a failure to express genes encoding enzymes required for their utilization. The ability to utilize other alternate carbon sources such as quinate and glycerol was only slightly affected by the acrB mutations, with the exception of ethanol where the acrB mutants grew considerably less well than wild type (Table 2).
|
Test medium containing 10 mM allyl alcohol in the presence of glucose was used to investigate the expression of the alcohol dehydrogenase encoded by alcA. All the acrB-containing strains, like the wild-type and creD34-containing strains, were resistant, indicating that they showed correct glucose repression of alcA. The acrB mutant strains were hypersensitive on medium containing glucose plus 10 mg/ml fluoroacetamide, indicating an increased level of the acetamidase expressed from the amdS gene compared to the wild-type strain, which is the opposite of the phenotype conferred by the creD34 mutation. The lack of growth of the acrB mutant strains on medium containing glucose plus 10 mM acrylamide as a nitrogen source indicates that this increased level of amdS expression is not due to constitutive expression, as acrylamide is a substrate of the acetamidase but not an inducer of amdS (![]()
Growth on media containing the
-amino acids 10 mM ß-alanine, 10 mM GABA, or 10 mM pyrrolidinone as nitrogen sources was significantly decreased in the acrB mutant strains compared to the wild-type strain, as was the case for a strain containing creD34. Similarly, growth of the mutant acrB strains on media containing 50 mM GABA and 50 mM pyrrolidinone acting as both a carbon and a nitrogen source was also decreased compared to wild type and the creD34 mutant strain, but this effect was not obvious on media containing 50 mM ß-alanine. The acrB mutant alleles affected growth to various degrees on media that had 10 mM pyrrolidinone as a nitrogen source, with the acrB15 strain having strong, almost wild-type-like growth, compared to the intermediate growth of the acrB14 strain and the weaker growth of the acrB2 strain, and this heterogeneity between alleles indicates that they do not all represent complete loss-of-function alleles.
Growth on media containing other amino acids as nitrogen sources, such as 10 mM proline and 10 mM glutamate, was unaffected by the acrB mutations. However, decreased utilization of 50 mM proline and 50 mM glutamate when they were used as both carbon and nitrogen sources was observed for the acrB mutant strains in comparison to the wild-type strain.
Partial suppression by acrB2 of creB and creC mutant phenotypes:
The creD34 mutation was identified as a suppressor of the hypersensitivity to fluoroacetamide conferred by the creC27 mutation. The effects of the creD34 mutation are pleiotropic in that it also leads to suppression of the effects of creC27 on other enzymes subject to carbon catabolite repression, such as alcohol dehydrogenase I, but it does not suppress the effects of creC27 that are apparent under derepressing conditions, such as the poor growth on D-quinate medium (![]()
![]()
![]()
![]()
The presence of the acrB2 mutation reversed the sensitivity conferred by the creB1937 and creC27 mutations to the presence of acriflavine in complete media (Fig 2C). The creD34 acrB2 double mutant strain was even more resistant to the presence of acriflavine than was either of the individual mutant strains, indicating an additive effect. The resistance of the creB1937 and creC27 strains to the presence of molybdate was also reversed in the relevant acrB2 double mutant strains and to a greater degree than that in the creD34 double mutant strains (Fig 2E). The acrB2 mutation also reversed the toxic effects of allyl alcohol added to D-glucose medium in creC27 and creB1937 backgrounds, the same phenotypic suppression previously seen for the creD34 mutation (Fig 2F).
|
The acrB2 mutation results in reduced growth compared to wild type on sole carbon sources such as fructose, maltose, starch, cellobiose, ethanol, and acetate, a phenotype not seen for the creD34 mutation (Fig 1; Table 2). This reduced growth is also seen in the acrB2creB1937 and acrB2creC27 double mutant strains compared to the single creB1937 and creC27 mutant phenotypes, respectively (Fig 2G). The inability of the creB1937 and creC27 mutant strains to utilize D-quinate as an alternate carbon source was partially suppressed by the acrB2 mutation in the double mutant strains, and this effect was more pronounced than that in the creD34 double mutant strains (Fig 2H). Finally, the acrB2creB1937 and acrB2creC27 strains grew as poorly as the acrB2 strain on glucose medium containing 10 mM pyrrolidinone as the nitrogen source (Fig 2I).
Molecular cloning of acrB:
We took advantage of the close genetic linkage of acrB and creB (![]()
![]()
![]()
![]()
![]()
30 kb from creB.
Cosmid SW23H06 was selected for further analysis. An EcoRI cutdown that contained a 10-kb insert, c24F6-14, complemented acrB2 in the transformation assay. c24F6-16 contained three ClaI fragments, which were cloned into pCB1004 (p4AcrB, p7AcrB, and p10AcrB), and p4AcrB, containing a 6-kb insert, was found to complement the acrB2 mutation, while p7AcrB and p10AcrB did not. Plasmids containing
2-kb SacI or KpnI deletions of each end of p4AcrB (p4AcrBSacI
and p4AcrBKpnI
) failed to complement acrB2 in the transformation assay. Thus acrB2 was located in the middle of the 6-kb insert of p4AcrB.
Sequencing of the insert in p4AcrB revealed a 3111-bp open reading frame (GenBank accession no.
AF485329; Fig 3). The acrB gene contained a single intron, which was determined by sequence analysis of PCR amplified cDNAs (see MATERIALS AND METHODS), and the intronic sequence conforms to the consensus 5' and 3' junction and lariat sequences for fungal introns (![]()
|
The acrB gene encodes a 1015-amino-acid polypeptide. AcrB is predicted to contain three transmembrane domains near the N terminus, at amino acid residues 158180 (I), 214236 (II), and 257274 (III), and a coiled-coil region, at amino acid residues 596753 (SMART protein motif analysis program; ![]()
![]()
A hypothetical protein is in contig 1168 of the TIGR Aspergillus fumigatus Genome Database, which shows 76% identity with the A. nidulans sequence, but these are very closely related ascomycete species. Database searches (SwissProt/SpTrEMBL/PDB) using the BlastP program (![]()
Molecular analysis of the acrB mutant alleles:
Three mutant alleles of acrB were sequenced to identify functional regions of the AcrB protein and to show that acrB rather than a suppressor of acrB2 had been isolated. We used a PCR approach using primers spanning the acrB gene followed by direct sequencing of the PCR products (see MATERIALS AND METHODS). The acrB2 mutation is a single base pair deletion at nucleotide (nt) +1734 at the 5' splice site of the only intron (Fig 3). This would be predicted to disrupt the splicing of the intron, resulting in a frameshift after amino acid 577 and the additional residues, GRYSFYGFRFVSMWSNLCLP, before terminating. The acrB15 mutant allele contains a 2-bp deletion at nt +1815, which results in a frameshift after amino acid 584, with an addition amino acid sequence of ATLISTILPNNHAEELDHQC before truncating. Both acrB2 and acrB15 gene products contain all three transmembrane domains but lack the coiled-coil region. The acrB14 allele contains a C-to-T transition plus a 1-bp insertion (T) at nt +627 that results in a frameshift after amino acid 209 and truncates 84 amino acids later. The additional amino acids are FARYHDCNGWFLPACMGPLYVDVGPEFCSRFSPCPGCHHSGRWRCREKWWCQCALRRYCSDSASHTQQRNTGFCRRPSCFSKNH. The acrB14 mutant gene product lacks two of the three transmembrane domains and the coiled-coil region and, since it is also recessive to the wild-type allele, probably represents a null allele.
| DISCUSSION |
|---|
In the multicellular eukaryote, A. nidulans, CreA, encoded by the creA gene, is the master DNA-binding repressor required for carbon catabolite repression of a wide range of genes (![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
![]()
Phenotypic analysis of the effects of three acrB alleles has shown that mutations in acrB have a broader range of phenotypes than the resistance to toxic compounds such as acriflavine, crystal violet, and malachite green previously described (![]()
-amino acids such as ß-alanine, GABA, and pyrrolidinone either as sole carbon and nitrogen sources or as nitrogen sources in the presence of D-glucose as a carbon source. Genetic analysis has shown that the acrB2 mutation is a suppressor of the phenotypes conferred by mutations in creB and creC. Strains containing the creB1937 and creC27 mutations show derepressed expression of the alcA gene, in that there is inappropriate expression in the presence of D-glucose, and the presence of the acrB2 mutation completely reverses the effects of these mutations as judged by plate testing. The reduced growth of the acrB2-containing strain on medium containing ethanol as a sole carbon source may indicate that this is due to a failure to induce alcA under either repressing or derepressing conditions due to the loss of acrB and that this failure in induction overrides the derepression caused by creB and creC mutations. The creB1937 and creC27 mutations lead to poor growth on D-quinate and D-glucuronate as sole carbon sources, and the acrB2 mutation partially repairs this defect. These phenotypes are consistent with a regulatory defect associated with the membrane and signaling, but not with a simple interpretation that only permeases and transporters are affected, as in the case of ethanol, a fat soluble compound, no permease is required or exists.
The amino acid sequence of AcrB indicates that the protein contains membrane-spanning domains, indicating the probability of its residing in the membrane. There is also a coiled-coil region that would allow the prediction that the protein forms either a homodimer or a heterodimer. The striking aspect of the sequence is the lack of sequence similarity with proteins in databases from other eukaryotes, including those for which the entire genome has been sequenced, and it is clearly not a direct homolog of any gene in a characterized signaling pathway. If functional homologs exist they are very diverged in sequence from AcrB and thus unrecognizable. The CreB and CreC proteins are involved in a deubiquitination network that removes ubiquitin from target proteins, and although these target proteins are not yet directly identified, the mutant phenotypes indicate that they are proteins involved in carbon metabolism and its regulation. Unlike AcrB, CreB and CreC are well conserved among most eukaryotes other than yeast. The acrB2 mutation suppresses phenotypes of the creB and creC mutations and this suggests that AcrB is involved in a process opposite to deubiquitination, such as a ubiquitin ligase pathway, since a failure to add ubiquitin to substrates could suppress the phenotypic effects of mutations that affect the removal of ubiquitin moieties. Thus the ubiquitination/deubiquitination network in A. nidulans that involves CreB, CreC, and AcrB provides an ideal genetic and molecular genetic system in which to unravel regulation of protein stability.
| FOOTNOTES |
|---|
Sequence data from this article have been deposited with the EMBL/GenBank Data Libraries under accession no. AF485329. ![]()
| ACKNOWLEDGMENTS |
|---|
We thank H. N. Arst for generously providing strains containing acrB14 and acrB15. This work was supported by an Australian Research Council grant to J.M.K. and an Australian Postgraduate Research Award to N.A.B.
Manuscript received October 31, 2002; Accepted for publication January 27, 2003.
| LITERATURE CITED |
|---|
ALTSCHUL, S. F., W. GISH, W. MILLER, E. W. MYERS, and D. J. LIPMAN, 1990 Basic local alignment search tool. J. Mol. Biol. 215:403-410.[Medline]
ARST, H. N., 1981 Aspects of the control of gene expression in fungi. Symp. Soc. Gen. Microbiol. 31:131-160.
ARST, H. N., and C. R. BAILEY, 1977 The regulation of carbon metabolism in Aspergillus nidulans, pp. 131146 in Genetics and Physiology of Aspergillus nidulans, edited by J. E. SMITH and J. A. PATEMAN. Academic Press, London.
ARST, H. N. and D. J. COVE, 1973 Nitrogen metabolite repression in Aspergillus nidulans.. Mol. Gen. Genet. 126:111-141.[Medline]
BAILEY, C. R. and H. N. ARST, 1975 Carbon catabolite repression in Aspergillus nidulans.. Eur. J. Biochem. 51:573-577.[Medline]
BRODY, H., J. GRIFFITH, A. J. CUTICCHIA, J. ARNOLD, and W. E. TIMBERLAKE, 1991 Chromosome-specific recombinant DNA libraries from the fungus Aspergillus nidulans.. Nucleic Acids Res. 19:3105-3109.
CADAVID, A. L. M., A. GINZEL, and J. A FISCHER, 2000 The function of the Drosophila Fat facets deubiquitinating enzyme in limiting photoreceptor cell number is intimately associated with endocytosis. Development 127:1727-1736.[Abstract]
CARROLL, A. M., J. A. SWEIGARD, and B. VALENT, 1994 Improved vectors for selecting resistance to hygromycin. Fungal Genet. Newsl. 41:22.
CHEN, X. and J. A. FISCHER, 2000 In vivo structure/function analysis of the Drosophila fat facets deubiquitinating enzyme gene. Genetics 156:1829-1836.
CHEN, X., B. ZHANG, and J. A. FISCHER, 2002 A specific protein substrate for a deubiquitinating enzyme: Liquid facets is the substrate of Fat facets. Genes Dev. 16:289-294.
CLUTTERBUCK, A. J., 1974 Aspergillus nidulans genetics, pp. 447510 in Handbook of Genetics, edited by R. C. KING. Plenum, New York.
CLUTTERBUCK, A. J., 1993 Fungi: A. nidulans (nuclear genes), pp. 3.713.84 in Genetic Maps: Locus Maps of Complex Genomes, edited by S. J. O'BRIEN. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY.
CLUTTERBUCK, A. J., 1997 The validity of the Aspergillus nidulans linkage map. Fungal Genet. Biol. 21:267-277.[Medline]
COVE, D. J., 1966 The induction and repression of nitrate reductase in the fungus Aspergillus nidulans.. Biochim. Biophys. Acta 133:51-56.
CUBERO, B. and C. SCAZZOCCHIO, 1994 Two different, adjacent and divergent zinc finger binding sites are necessary for CreA mediated carbon catabolite repression in the proline gene cluster of Aspergillus nidulans.. EMBO J. 13:407-415.[Medline]
DE CRAENE, J.-O., O. SOETENS, and B. ANDRE, 2001 The Npr1 kinase controls biosynthetic and endocytic sorting of the Yeast Gap1 permease. J. Biol. Chem. 276:43939-43948.
DOWZER, C. E. A. and J. M. KELLY, 1989 Cloning of creA from Aspergillus nidulans: a gene involved in carbon catabolite repression. Curr. Genet. 15:457-459.[Medline]
DOWZER, C. E. A. and J. M. KELLY, 1991 Analysis of the creA gene, a regulator of carbon catabolite repression in Aspergillus nidulans.. Mol. Cell. Biol. 11:5701-5709.
GALAN, J. M., V. MOREAU, B. ANDRE, C. VOLLAND, and R. HAGUENAUER-TSAPIS, 1996 Ubiquitination mediated by the Npi1/Rsp5p Ubiquitin-protein ligase is required for endocytosis of the yeast uracil permease. J. Biol. Chem. 271:10946-10952.
GURR, S. J., S. E. UNKLES and J. R. KINGHORN, 1987 The structure and organisation of nuclear genes of filamentous fungi, pp. 93139 in Gene Structure in Eukaryotic Microbes, edited by J. R. KINGHORN. IRL Press, Oxford.
HYNES, M. J. and J. A. PATEMAN, 1970 The genetic analysis of regulation of amidase synthesis in Aspergillus nidulans. I. Mutants able to use acrylamide. Mol. Gen. Genet. 108:95-106.
HYNES, M. J. and J. M. KELLY, 1977 Pleiotropic mutants of Aspergillus nidulans altered in carbon metabolism. Mol. Gen. Genet. 150:193-204.[Medline]
KELLY, J. M., 1980 Pleiotropic mutants of Aspergillus nidulans affected in carbon metabolism. Ph.D. Thesis, La Trobe University, Melbourne.
KELLY, J. M. and M. J. HYNES, 1977 Increased and decreased sensitivity to carbon catabolite repression of enzymes of acetate metabolism in mutants of Aspergillus nidulans.. Mol. Gen. Genet. 156:87-92.[Medline]
KROGH, A., B. LARSSON, G. VON HIJNE, and E. L. L. SONNHAMMER, 2001 Predicting transmembrane protein topology with a hidden Markov model: application to complete genomes. J. Mol. Biol. 305:567-580.[Medline]
KULMBERG, P., M. MATHIEU, C. E. A. DOWZER, J. M. KELLY, and B. FELENBOK, 1993 Specific binding sites in the alcR and alcA promoters of the ethanol regulon for the CreA repressor mediating carbon catabolite repression in Aspergillus nidulans.. Mol. Microbiol. 7:847-857.[Medline]
LEE, S. B., and J. W. TAYLOR, 1990 Isolation of DNA from fungal mycelia and single spores, pp. 282287 in PCR Protocols: A Guide to Methods and Applications, edited by M. A. INNIS, D. H. GELFAND, J. S. SNINSKY and T. J. WHITE. Academic Press, London.
LOCKINGTON, R. A. and J. M. KELLY, 2001 Carbon catabolite repression in Aspergillus nidulans involves deubiquitination. Mol. Microbiol. 40:1311-1321.[Medline]
LOCKINGTON, R. A. and J. M. KELLY, 2002 The WD40-repeat protein CreC interacts with and stabilizes the deubiquitinating enzyme CreB in vivo in Aspergillus nidulans.. Mol. Microbiol. 43:1173-1182.[Medline]
LOCKINGTON, R. A., H. M. SEALY-LEWIS, C. SCAZZOCCHIO, and R. W. DAVIES, 1985 Cloning and characterization of the ethanol utilization regulon of Aspergillus nidulans.. Gene 33:137-149.[Medline]
MATHIEU, M. and B. FELENBOK, 1994 The Aspergillus nidulans CREA protein mediates glucose repression of the ethanol regulon at various levels through competition with the ALCR-specific transactivator. EMBO J. 13:4022-4027.[Medline]
MATHIEU, M., S. FILLINGER, and B. FELENBOK, 2000 In vivo studies of upstream regulatory cis-acting elements of the alcR gene encoding the transactivator of the ethanol regulon in Aspergillus nidulans.. Mol. Microbiol. 36:123-131.[Medline]
OAKLEY, C. E., C. F. WEIL, P. L. KRETZ, and B. R. OAKLEY, 1987 Cloning of the riboB locus of Aspergillus nidulans.. Gene 53:293-298.[Medline]
OLDHAM, C. E., R. P. MOHNEY, S. L. H. MILLER, R. N. HANES, and J. P. O'BRYAN, 2002 The ubiquitin-interacting motifs target the endocytic adaptor protein epsin for ubiquitination. Curr. Biol. 12:1112-1116.[Medline]
PANOZZO, C., E. CORNILLOT, and B. FELENBOK, 1998 The CreA repressor is the sole DNA-binding protein responsible for carbon catabolite repression of the alcA gene in Aspergillus nidulans via its binding to a couple of sites. J. Biol. Chem. 273:6367-6372.
PATEMAN, J. A., B. M. ROVER, and D. J. COVE, 1967 Genetical and biochemical studies of nitrate assimilation in Aspergillus nidulans.. Biochem. J. 104:103-111.[Medline]
ROPER, J. A. and E. KAFER, 1957 Acriflavine resistant mutants of Aspergillus nidulans.. J. Gen. Microbiol. 16:660-667.
ROTIN, D., O. STAUB, and R. HAGUENAUER-TSAPIS, 2000 Ubiquitination and endocytosis of plasma membrane proteins: role of Nedd4/Rsp5p family of ubiquitin-protein ligases. J. Membr. Biol. 176:1-17.[Medline]
SAMBROOK, J., E. F. FRITSCH and T. MANIATIS, 1989 Molecular Cloning: A Laboratory Manual. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY.
SCAZZOCCHIO, C., V. GAVRIAS, B. CUBERO, C. PANOZZO, and M. MATHIEU et al., 1995 Carbon catabolite repression in Aspergillus nidulansa review. Can. J. Bot. 73:S160-S166.
SCHULTZ, J., F. MILPETZ, P. BORK, and C. P. PONTING, 1998 SMART, a simple modular architecture research tool: identification of signaling domains. Proc. Natl. Acad. Sci. USA 95:5857-5864.
SHROFF, R. A., R. A. LOCKINGTON, and J. M. KELLY, 1996 Analysis of mutations in the creA gene involved in carbon catabolite repression in Aspergillus nidulans.. Can. J. Microbiol. 42:950-959.[Medline]
SHROFF, R. A., S. M. O'CONNOR, M. J. HYNES, R. A. LOCKINGTON, and J. M. KELLY, 1997 Null alleles of creA, the regulator of carbon catabolite repression in Aspergillus nidulans.. Fungal Genet. Biol. 22:28-38.[Medline]
SOETENS, O., J.-O. DE CRAENE, and B. ANDRE, 2001 Ubiquitin is required for sorting to the vacuole of the yeast general amino acid permease, Gap1. J. Biol. Chem. 276:43949-43957.
SPRINGAEL, J.-Y. and B. ANDRE, 1998 Nitrogen-regulated ubiquitination of Gap1 Permease of Saccharomyces cerevisiae.. Mol. Biol. Cell 9:1253-1263.
SPRINGAEL, J.-Y., E. NIKKO, B. ANDRE, and A. M. MARINI, 2002 Yeast Npi3/Bro1 is involved in ubiquitin-dependent control of permease trafficking. FEBS Lett. 517:103-109.[Medline]
STRAUSS, J., R. L. MACH, S. ZEILINGER, G. HARTLER, and G. STOFFLER et al., 1999 Cre1, the carbon catabolite repressor protein from Trichoderma reesei.. FEBS Lett. 376:103-107.
SWAMINATHAN, S., A. Y. TAMERIK, and M. HOECHSTRASSER, 1999 The Doa4 Deubiquitinating enzyme is required for ubiquitin homeostasis in Yeast. Mol. Biol. Cell 10:2583-2594.
TILBURN, J., C. SCAZZOCCHIO, G. T. TAYLOR, J. H. ZABICKY-ZISSMAN, and R. A. LOCKINGTON et al., 1983 Transformation by integration in Aspergillus nidulans.. Gene 26:205-221.[Medline]
TODD, R. B., R. A. LOCKINGTON, and J. M. KELLY, 2000 The Aspergillus nidulans creC gene involved in carbon catabolite repression encodes a WD40 repeat protein. Mol. Gen. Genet. 263:561-570.[Medline]
WU, Z. R., Q. H. LI, M. E. FORTINI, and J. A. FISCHER, 1999 Genetic analysis of the role of the Drosophila fat facets gene in the ubiquitin pathway. Dev. Genet. 25:312-320.[Medline]
YASHIRODA, H., T. OGUCHI, Y. YASUDA, A. TOH-E, and Y. KIKUCHI, 1996 Bul1, a new protein that binds to the Rsp5 Ubiquitin ligase in Saccharomyces cerevisiae. Mol. Cell. Biol. 16:3255-3263.
YASHIRODA, H., T. D. KAIDA, A. TOH-E, and Y. KIKUCHI, 1998 The PY-motif of Bul1 protein is essential for growth of Saccharomyces cerevisiae under various stress conditions. Gene 225:39-46.[Medline]
This article has been cited by other articles:
![]() |
M. E. Katz, C. J. Evans, E. E. Heagney, P. A. vanKuyk, J. M. Kelly, and B. F. Cheetham Mutations in Genes Encoding Sorting Nexins Alter Production ofIntracellular and Extracellular Proteases in Aspergillus nidulans Genetics, April 1, 2009; 181(4): 1239 - 1247. [Abstract] [Full Text] [PDF] |
||||
- THIS ARTICLE
-
Abstract
- Full Text (PDF)
- Alert me when this article is cited
- Alert me if a correction is posted
- SERVICES
- Email this article to a friend
- Similar articles in this journal
- Similar articles in PubMed
- Alert me to new issues of the journal
- Download to citation manager
- Reprints & Permissions
- CITING ARTICLES
- Citing Articles via HighWire
- Citing Articles via Google Scholar
- GOOGLE SCHOLAR
- Articles by Boase, N. A.
- Articles by Kelly, J. M.
- Search for Related Content
- PUBMED
- PubMed Citation
- Articles by Boase, N. A.
- Articles by Kelly, J. M.



